close all open/close all

CDS information : Griseo_00300


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction32,829 / 34,037 / + [in whole cluster]
32,829 / 34,037 / + [in contig]
Location32829..34037 [in whole cluster]
32829..34037 [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/putative ketoreductase
Product (GenBank)putative bifunctional cyclase/3-oxoacyl-ACP reductase GrhT
Gene
Gene (GenBank)grhT
EC number
Keyword
  • 1st and 2nd ring
  • unreduced polyketide
Note
  • bifunctional protein
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
[8692863] Deciphering the mechanism for the assembly of aromatic polyketides by a bacterial polyketide synthase. (Proc Natl Acad Sci U S A. , 1996)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[18388203] Crystal structure and functional analysis of tetracenomycin ARO/CYC: implications for cyclization specificity of aromatic polyketides. (Proc Natl Acad Sci U S A. , 2008)
ACC
B1GSM5
NITE
Bena_00150
PmId
[17625850] Biosynthesis of pentangular polyphenols: deductions from the benastatin and griseorhodin pathways. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative cyclase/putative ketoreductase [putative bifunctional cyclase/3-oxoacyl-ACP reductase GrhT]
MAGHTSNSIVIDAPMDLVWERTNDVASWTELFSEYSLAEILEEDGPTVTFRLALHPDENG
KVWSWVSRRTTDVASRTVRAHRVETGPFAYMNIHWEYVQTDAGVRMQWTQDFHMKDEAPI
DDAGMTDRINRNSVVQMGLIKSRIEAAARAARTPFADLAGKRIVVTGGSRGIGRGIVLAA
ARAGADVVTCYREENDHTASLAKELAPLPGSQHLLRADVSEAAGARLLADRARELLGGLD
AVVNNAGDFAPRPYTELTDAAWATALQSNLTSTHQVIQAALPLLGAGGSIVNLGSTVARI
GMAGGVHYTAVKQALVGLTRSLARELGPRGIRVNTLSPGRIATEALDALPPEEAARQRAV
FSKFAALGRLGTPQEIADVVLFLISDQSSYITGQNIHVDGCV
selected fasta
>putative cyclase/putative ketoreductase [putative bifunctional cyclase/3-oxoacyl-ACP reductase GrhT]
ATGGCAGGCCACACGTCCAACTCCATCGTCATCGACGCCCCGATGGACCTCGTCTGGGAG
CGCACGAACGACGTGGCGTCCTGGACCGAACTGTTCAGCGAGTACTCCCTCGCCGAGATC
CTGGAGGAGGACGGCCCGACCGTCACCTTCCGGCTGGCCCTGCACCCGGACGAGAACGGG
AAGGTGTGGAGCTGGGTCTCCCGGCGCACCACCGATGTGGCGTCCCGCACCGTCCGCGCC
CACCGCGTCGAGACCGGCCCCTTCGCGTACATGAACATCCACTGGGAGTACGTCCAGACC
GACGCGGGCGTCCGGATGCAGTGGACGCAGGACTTCCACATGAAGGACGAGGCCCCGATC
GACGACGCGGGCATGACCGACCGCATCAACCGCAACAGCGTGGTCCAGATGGGTCTCATC
AAGTCCAGGATCGAGGCCGCCGCCCGCGCGGCGCGCACCCCCTTCGCCGATCTGGCGGGC
AAGCGGATCGTGGTCACGGGCGGCTCGCGGGGCATCGGGCGGGGCATCGTGCTCGCCGCC
GCCCGGGCCGGCGCGGACGTGGTGACCTGCTACCGCGAGGAGAACGACCACACCGCGTCG
CTGGCCAAGGAGCTGGCGCCGCTCCCGGGCTCGCAGCACCTGCTGCGGGCGGACGTGAGC
GAGGCGGCCGGCGCCCGGCTGCTGGCGGACCGGGCGCGGGAGCTGCTCGGCGGGCTGGAC
GCGGTCGTCAACAACGCCGGCGACTTCGCGCCGCGGCCCTACACGGAGCTGACCGACGCG
GCGTGGGCCACCGCGCTGCAGTCGAACCTGACCAGCACCCACCAGGTGATCCAGGCCGCC
CTGCCGCTGCTGGGCGCGGGCGGGTCGATCGTCAACCTCGGCTCCACGGTGGCCCGTATC
GGCATGGCCGGGGGCGTGCACTACACGGCGGTCAAGCAGGCCCTGGTCGGTCTGACCCGC
TCGCTGGCCCGCGAGCTGGGGCCGCGCGGCATCCGGGTCAACACGCTCTCGCCGGGCCGC
ATCGCCACCGAGGCGCTCGACGCGCTGCCGCCCGAGGAGGCCGCCCGGCAGCGCGCGGTC
TTCTCGAAGTTCGCCGCTCTCGGCCGGCTCGGCACCCCGCAGGAGATCGCGGACGTCGTG
CTCTTCCTGATCAGCGACCAGTCCTCCTACATCACCGGACAGAACATCCACGTCGACGGC
TGCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [237-248]  3.29999802154459e-10 PR00080 [288-296]  3.29999802154459e-10 PR00080 [308-327]  3.29999802154459e-10 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [162-179]  2.60000517657733e-38 PR00081 [237-248]  2.60000517657733e-38 PR00081 [282-298]  2.60000517657733e-38 PR00081 [308-327]  2.60000517657733e-38 PR00081 [329-346]  2.60000517657733e-38 PR00081 [366-386]  2.60000517657733e-38 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [157-400]  1e-79 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR019587 Polyketide cyclase/dehydrase (Family)
 [4-126]  1.4e-09 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [4-117]  2.5e-12 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit