close all open/close all

CDS information : Griseo_00310


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction34,070 / 34,819 / + [in whole cluster]
34,070 / 34,819 / + [in contig]
Location34070..34819 [in whole cluster]
34070..34819 [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative ketoreductase
Product (GenBank)putative 3-oxoacyl-ACP reductase GrhO10
Gene
Gene (GenBank)grhO10
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)
Related Reference
ACC
B1GSM5
NITE
Bena_00150
PmId
[17625850] Biosynthesis of pentangular polyphenols: deductions from the benastatin and griseorhodin pathways. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative ketoreductase [putative 3-oxoacyl-ACP reductase GrhO10]
MELGLQGKKLLVTGGSRGIGRGVVLAAARAGADVLTCYVNDSEHVESLRRELKALGGDHE
VVRADVGDLDQVDALVGWARERYGKLDGIVNNAGVISHIPFAELAPDEWSRVLDTNLTAA
YRVIQQSLPLLGSGASVVNIGSRGAAAGIPLRAHYTAAKAAMIGLTRSLAKELGGKGIRV
NVVAPGVIETEAFDTMPAERAEGLRAMYAQKTALARLGRVDELAAPVLFLLSDLAAYVTG
ETLNVDGGI
selected fasta
>putative ketoreductase [putative 3-oxoacyl-ACP reductase GrhO10]
GTGGAACTCGGACTGCAGGGAAAGAAGCTTCTGGTCACCGGGGGCTCCCGGGGCATCGGA
CGCGGCGTCGTGCTCGCCGCCGCCCGCGCCGGAGCCGACGTACTGACCTGCTACGTGAAC
GACAGCGAGCACGTCGAGAGCCTTCGCCGGGAGCTGAAGGCGCTCGGCGGCGACCACGAG
GTCGTCCGGGCGGACGTGGGCGACCTGGACCAGGTCGACGCCCTGGTCGGGTGGGCCAGG
GAGAGGTACGGCAAGCTCGACGGCATCGTCAACAACGCGGGCGTCATCAGCCACATACCG
TTCGCCGAGCTCGCCCCCGACGAGTGGTCGCGCGTCCTGGACACCAACCTGACGGCCGCC
TACCGCGTCATCCAGCAGTCGCTGCCGCTGCTCGGGTCCGGCGCCTCCGTCGTCAACATC
GGTTCGCGCGGGGCCGCGGCCGGCATTCCGCTGCGCGCCCACTACACCGCCGCCAAGGCG
GCCATGATCGGCCTGACCCGCTCGCTCGCCAAGGAGCTGGGCGGCAAGGGGATCCGGGTC
AACGTGGTCGCCCCGGGCGTCATCGAAACCGAGGCGTTCGACACGATGCCCGCCGAGCGC
GCGGAGGGGCTGCGGGCGATGTACGCGCAGAAGACCGCCCTGGCGCGGCTGGGCCGGGTC
GACGAGCTGGCCGCGCCGGTCCTGTTCCTGCTCAGCGACCTCGCGGCGTACGTCACGGGC
GAGACCCTCAACGTGGACGGGGGCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [10-173]  1.70000000000001e-37 PF00106
PF00106   adh_short
 [84-95]  2.09999806691534e-11 PR00080 [135-143]  2.09999806691534e-11 PR00080 [155-174]  2.09999806691534e-11 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  6.00001679190159e-37 PR00081 [84-95]  6.00001679190159e-37 PR00081 [129-145]  6.00001679190159e-37 PR00081 [155-174]  6.00001679190159e-37 PR00081 [176-193]  6.00001679190159e-37 PR00081 [213-233]  6.00001679190159e-37 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-248]  6.99999999999989e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-32]  0.344 Signal
Bacteria, Gram-positive   
TMHMM No significant hit