close all open/close all

CDS information : Griseo_00320


close this sectionLocation

Organism
StrainJP95
Entry nameGriseorhodin A
Contig
Start / Stop / Direction34,821 / 35,144 / + [in whole cluster]
34,821 / 35,144 / + [in contig]
Location34821..35144 [in whole cluster]
34821..35144 [in contig]
TypeCDS
Length324 bp (107 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)GrhU
Gene
Gene (GenBank)grhU
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12323376] A gene cluster from a marine Streptomyces encoding the biosynthesis of the aromatic spiroketal polyketide griseorhodin A. (Chem Biol. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [GrhU]
MSDATFRVMLRMQIKPGMEADFERVWKEVGGSVTSDPANRGQWLSRSTTADEDGVYYIIS
DWVDEPQFRRFETSDTHLSHRTKLHPYRSGGSMATMDIVASLSGAAA
selected fasta
>hypothetical protein [GrhU]
GTGTCCGACGCGACGTTCCGGGTGATGCTGCGCATGCAGATCAAGCCCGGCATGGAGGCC
GACTTCGAGCGGGTGTGGAAGGAGGTCGGCGGCTCGGTCACCAGCGACCCGGCCAACCGG
GGGCAGTGGCTGTCCCGGAGCACGACCGCCGACGAGGACGGCGTCTACTACATCATCAGC
GACTGGGTGGACGAGCCGCAGTTCCGCCGGTTCGAGACCAGCGACACCCACCTGTCGCAC
CGCACCAAGCTGCATCCGTACCGCAGCGGCGGCTCCATGGCGACGATGGACATTGTCGCG
AGCCTCTCCGGGGCGGCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [6-81]  2.3e-15 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [5-99]  9.59999914716171e-16 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit