close all open/close all
first first   Griseu_00020 Griseu_00020

CDS information : Griseu_00010


close this sectionLocation

Organism
StrainK-63
Entry nameGriseusin
Contig
Start / Stop / Direction190 / 1,458 / + [in whole cluster]
190 / 1,458 / + [in contig]
Location190..1458 [in whole cluster]
190..1458 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketosynthase
Gene
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketosynthase]
MERRAVITGIGVCAPGGTGVDSFWELMCDGRTATRGITLFDPSPYRSRVAAEIDFDPRAH
GLTPQEIRRMDRAAQFGVVTAREAFADSGLDGAALDPFRTGVSLGTAIGAAGGLDAEYRV
VSDDGRLELVDHRYATPHLYDLFVPSSFATEVAWAVGAEGPATVVSTGCTAGIDAVGHAV
EAIRDGSADVMVTGAVDAPITPLTMAAFDAIRATTSLNDEADTASRPFDASRKGFVLGEG
AAVFVLEEAEHARRRGAYVYAEIAGYASRGNAFHMTGLRSDGAELAAAIRAALDEARLDA
SAVDYVNAHGSGTRQNDRHETVALKSALGQHAHRVPVSAIKSMVGHSLGAIGSIEIAACA
LAMRHHVIPPTANLHTPDPECDLDYVPLTARAQRTDAVLTIGSGFGGFQSAMVLARPDRS
AA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketosynthase]
GTGGAACGCCGGGCAGTGATCACGGGAATCGGTGTGTGCGCACCGGGCGGAACCGGTGTG
GACAGCTTCTGGGAGCTGATGTGCGACGGCCGGACGGCCACCCGCGGCATCACCCTCTTC
GACCCGTCTCCGTACCGCTCCAGGGTCGCCGCCGAGATCGACTTCGACCCGCGGGCGCAC
GGGCTGACGCCGCAGGAGATCCGGCGGATGGACCGGGCCGCGCAGTTCGGCGTGGTGACG
GCACGGGAGGCCTTCGCCGACAGCGGGCTCGACGGCGCCGCGCTCGATCCGTTCCGTACG
GGAGTCAGCCTCGGCACCGCGATCGGCGCGGCCGGCGGCCTGGACGCGGAGTACCGCGTG
GTCAGCGACGACGGCCGGCTGGAGCTGGTCGACCACCGGTACGCGACCCCGCATCTGTAC
GACCTGTTCGTGCCGAGCTCCTTCGCGACCGAAGTGGCCTGGGCCGTCGGCGCGGAAGGA
CCGGCGACGGTGGTGTCCACCGGCTGCACCGCCGGGATCGACGCGGTGGGCCACGCGGTG
GAGGCGATCCGCGACGGCAGCGCCGATGTGATGGTCACCGGCGCGGTGGACGCGCCGATC
ACCCCGCTCACGATGGCGGCCTTCGACGCGATCCGCGCCACCACGTCCCTCAACGACGAG
GCGGACACCGCCTCCCGCCCCTTCGACGCGTCACGCAAGGGCTTCGTCCTCGGTGAGGGG
GCGGCGGTGTTCGTCCTGGAGGAGGCGGAGCACGCACGGCGCAGAGGCGCGTACGTGTAC
GCGGAGATCGCCGGATACGCCTCGCGCGGCAACGCCTTCCACATGACCGGACTGCGGTCC
GACGGAGCGGAGCTGGCCGCCGCGATCCGGGCGGCGCTGGACGAGGCCCGGCTCGACGCG
TCGGCGGTGGACTACGTCAACGCGCACGGTTCCGGCACCCGCCAGAACGACCGGCACGAG
ACGGTCGCGCTCAAGTCGGCTCTGGGACAGCACGCCCACCGGGTGCCGGTCAGCGCGATC
AAGTCGATGGTCGGGCACTCGCTCGGGGCGATCGGCTCCATCGAGATCGCCGCCTGCGCA
CTGGCCATGCGGCACCACGTCATCCCTCCGACCGCCAATCTGCACACCCCGGATCCCGAG
TGCGATCTCGACTATGTCCCGCTGACGGCCCGCGCGCAGCGCACCGATGCCGTCCTCACC
ATCGGCAGCGGATTCGGCGGCTTCCAGAGCGCGATGGTGCTGGCCCGTCCCGACAGGAGC
GCCGCGTGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  1.5e-61 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  7.69999999999997e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-265]  2.39999999999997e-66 G3DSA:3.40.47.10 [270-417]  2.99999999999998e-51 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  5.10003242202156e-69 SSF53901 [219-418]  6.39998633403535e-64 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.644 Signal
Eukaryota   
TMHMM No significant hit
first first   Griseu_00020 Griseu_00020