close all open/close all

CDS information : Griseu_00040


close this sectionLocation

Organism
StrainK-63
Entry nameGriseusin
Contig
Start / Stop / Direction3,201 / 3,986 / + [in whole cluster]
3,201 / 3,986 / + [in contig]
Location3201..3986 [in whole cluster]
3201..3986 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
Related Reference
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
MSDQDKRVAVVTGATSGIGLSVARLLASQGHRVFIGARSAENVAATVKELVAEGLDVDGA
VVDVRSDADVEAWIQAAVDRFGTVDVVVNNAGRSGGGVTADIDPELWHDVIDTNLNSVFR
VTRSALNTGGLRSKSRGRIINIASTAGKQGVVLGAPYSASKHGVVGFTKALGNELAPTGI
TVNAVCPGYVETPMAQRVRQGYAAAYDATEDAILEKFQAKIPLGRYSTPDEVAGLVGYLA
SDTAASITSQALNVCGGLGNF
selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
ATGTCGGATCAGGACAAGCGCGTCGCCGTCGTCACCGGAGCCACCAGCGGCATCGGACTG
TCCGTCGCGCGCCTGCTGGCCTCACAGGGCCACCGTGTGTTCATCGGCGCGCGCAGCGCG
GAGAACGTCGCCGCGACCGTCAAGGAGCTCGTGGCCGAGGGCCTCGACGTCGACGGCGCG
GTGGTGGACGTCCGCAGCGACGCCGATGTCGAGGCCTGGATCCAGGCCGCCGTGGACCGC
TTCGGCACCGTCGACGTCGTCGTCAACAACGCGGGCCGCTCCGGCGGCGGCGTCACCGCG
GACATCGACCCGGAGCTGTGGCACGACGTCATCGACACCAATCTCAACTCGGTCTTCCGC
GTCACGCGTTCGGCGCTGAACACCGGCGGCCTGCGGTCCAAGAGCCGCGGCCGGATCATC
AACATCGCCTCCACGGCCGGCAAGCAGGGTGTGGTGCTCGGTGCGCCGTACTCCGCGTCC
AAGCACGGCGTGGTCGGCTTCACCAAGGCGCTCGGCAACGAGCTGGCGCCGACCGGCATC
ACCGTCAACGCCGTCTGCCCCGGATACGTCGAGACGCCGATGGCGCAGCGCGTGCGGCAG
GGGTACGCCGCGGCGTACGACGCCACCGAGGACGCGATCCTGGAGAAGTTCCAGGCGAAG
ATCCCGCTCGGCCGCTACTCCACGCCGGACGAGGTCGCCGGACTCGTCGGCTACCTGGCC
TCGGACACCGCGGCCTCCATCACCTCGCAGGCGCTCAACGTCTGCGGCGGACTCGGCAAC
TTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1-253]  2.89999717862184e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
 [82-93]  2.09999806691534e-14 PR00080 [137-145]  2.09999806691534e-14 PR00080 [157-176]  2.09999806691534e-14 PR00080
PR00080   SDRFAMILY
 [8-175]  1.9e-34 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  4.19999771339582e-49 PR00081 [82-93]  4.19999771339582e-49 PR00081 [131-147]  4.19999771339582e-49 PR00081 [157-176]  4.19999771339582e-49 PR00081 [178-195]  4.19999771339582e-49 PR00081 [222-242]  4.19999771339582e-49 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-258]  1.9e-81 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-23]  0.133 Signal
Eukaryota   
 [1-27]  0.554 Signal
Bacteria, Gram-positive   
TMHMM No significant hit