close all open/close all
Griseu_00040 Griseu_00040   last last

CDS information : Griseu_00050


close this sectionLocation

Organism
StrainK-63
Entry nameGriseusin
Contig
Start / Stop / Direction4,051 / 5,010 / + [in whole cluster]
4,051 / 5,010 / + [in contig]
Location4051..5010 [in whole cluster]
4051..5010 [in contig]
TypeCDS
Length960 bp (319 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)putative cyclase/dehydrase
Gene
Gene (GenBank)
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)
Related Reference
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>cyclase/dehydratase [putative cyclase/dehydrase]
MSQPGLREVEHEITVSAPAAAVYRLIAEVRNWPRIFPPTIYVDHVEENGDEERIRIWATA
NDEAKNWTSRRTLDPEGLRITFRQEVPAPPVAAMGGAWIIEPLGDAESRIRLLHDYRAVD
DDPAHLEWIDQAVDRNSRSELAALKGNVEKAHAEEGLTFSFEDTVRVDGAAKDVYDFVNE
ADLWHERLPHVATVRLREDTPGLQELEMDTRAKDGSTHTTKSYRVTFPHQRIAYKQTTLP
ALMTLHTGYWTFAEDDRGVLASSQHTVTINTANIARVLGPEATVEDAKAYVHTALSTNST
ATLNHAKRFAEERAAGRRG
selected fasta
>cyclase/dehydratase [putative cyclase/dehydrase]
ATGTCGCAGCCCGGCCTGCGCGAGGTGGAGCACGAGATCACGGTCTCCGCTCCCGCCGCC
GCCGTCTACCGTCTGATCGCCGAGGTCCGCAACTGGCCCCGGATCTTCCCGCCGACCATC
TACGTCGACCACGTCGAGGAGAACGGCGACGAGGAGCGCATCCGTATCTGGGCCACGGCC
AACGACGAGGCCAAGAACTGGACCTCGCGCCGCACGCTGGACCCGGAAGGCCTGCGGATC
ACCTTCCGCCAGGAGGTTCCGGCGCCGCCGGTCGCCGCCATGGGCGGCGCCTGGATCATC
GAGCCGCTCGGCGACGCCGAGTCACGGATCCGTCTGCTGCACGACTACCGCGCGGTCGAC
GACGACCCGGCGCACCTGGAGTGGATCGACCAGGCGGTCGACCGCAACTCCCGCTCCGAA
CTGGCGGCCCTGAAGGGCAACGTCGAGAAGGCGCACGCCGAGGAGGGGCTGACGTTCTCC
TTCGAGGACACGGTGCGGGTCGACGGTGCGGCGAAGGACGTCTACGACTTCGTCAACGAG
GCCGACCTGTGGCACGAGCGGCTGCCGCACGTCGCCACCGTACGGCTGCGCGAGGACACT
CCCGGCCTCCAGGAGCTGGAGATGGACACCCGGGCCAAGGACGGCTCGACCCACACCACC
AAGTCGTACCGGGTGACCTTTCCGCACCAGCGGATCGCCTACAAGCAGACCACGCTGCCG
GCGCTGATGACCCTGCACACCGGCTACTGGACCTTCGCCGAGGACGACCGGGGCGTGCTG
GCCTCCTCCCAGCACACGGTCACCATCAACACCGCCAACATCGCCCGCGTCCTCGGCCCG
GAGGCCACCGTCGAGGACGCCAAGGCGTATGTGCACACCGCGCTGTCCACCAACAGCACG
GCCACGCTGAACCACGCCAAGCGGTTCGCCGAGGAGCGTGCCGCGGGCCGGCGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [8-149]  2.2e-11 PF10604 [159-308]  1.3e-07 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [8-139]  1.5e-15 G3DSA:3.30.530.20 [161-264]  1.5e-15 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit
Griseu_00040 Griseu_00040   last last