close all open/close all
first first   Halsto_00020 Halsto_00020

CDS information : Halsto_00010


close this sectionLocation

Organism
StrainHC34
Entry nameHalstoctacosanolide
Contig
Start / Stop / Direction1,000 / 13,584 / + [in whole cluster]
1,000 / 13,584 / + [in contig]
Location1000..13584 [in whole cluster]
1000..13584 [in contig]
TypeCDS
Length12,585 bp (4,194 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)hlsA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16568718] The complete biosynthetic gene cluster of the 28-membered polyketide macrolactones, halstoctacosanolides, from Streptomyces halstedii HC34. (J Antibiot (Tokyo). , 2006)

close this sectionPKS/NRPS Module

0 methylmalonyl-CoA
1 methylmalonyl-CoA
2 malonyl-CoA
KSQ6..367
AT537..851
ACP927..997
KS1019..1398
AT1553..1867
KR2197..2377
ACP2480..2550
KS2576..2954
AT3114..3430
KR3761..3941
ACP4044..4114

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MSATGRIAVVGMSCRLPGALDLGEFWDLLMSSGSGVGLPGSDRSRRLDDSHEPRRAGYLQ
QVDLFDASFFGLGPQEATAMDPRQRLILELSWEALENAGISPAGLAGSSVGVFLGASGDD
YPGAGTVADANPYLAAGTNRAVIANRVSHALDLTGPSLLVDTAQSSSLVAVHMACESIRR
GECTTAIVGGVNLNLSSRRIHMLESLGVVSPDGECFTFDARANGFVPGEGGGVLVLKDLS
AALADGGQVHAVIRGTALNHDGATFGLSSPSPAAQEAVIRQAHRAADVLPGDVRFVELHG
TGTQAGDATEATALGAAFAGDSPRESPLLVGSVKTNIGHLDAASGAVGLIKAVLSLTNRK
LPPSRNFAEPNPAIDLPALGLEVATSVRDLAGDSGESPVQAGVSSFGMGGANCHVVVSDA
LDLDTSAPRPSTETASDTPPETSDGVLVPWVVSGRGVDGVRAQAARLREWVLERSADRPV
DVGFSLLSSRSLHRDRLVVLGSDRQVLVDGLAAFVEGAPWPGVVGGSGGGVVADRAVFVF
PGQGSQWVGMGRELYASSPVFRARLDECAAALDPLVDWSLIDVVRGGSGAPGLERVDVVQ
PVLWAVMVSLAAVWESWGVVPAAVVGHSQGEIAAACVAGALSVVDAARVVALRSRALRAM
AGDGAMVSVALPVAEAEALTGDGVSLAAVNGPSSVVLSGDRSALTPVVERLSAEGVRTKW
VPVDYASHSAHMERIHDELLEILSGIVPKTSRIPLYSTVSAEVIDTSVMDAGYWFDNIRG
TVRFHETVQALIADGLTAFVEISPHPVLAMSVQDTLDQAEATGLSIGTLRRDENEEKSLL
TAAAELFVAGLPIDWNTAAFADLDTRQVDLPTYAFQRRPYWLETVAQTVRVGAPAAAPTE
SPEVPGSRSPLAERVAGLPQGARHQAVTDFVRAHAAAVLGHTDHSDIDVALTFRDLGFDS
INATEFRLRLGDAAGLRLPATLVFDHPTPAVVVDFLLTRLLGGEADSLPSTRTAASDPDE
PVAIVGMACRFPGGVSTPEQLWRLVAEGVDAVSGLPTDRGWDIESLYHPDPDHPGTSYAN
EGGFLHEAGEFDAGFFGISPREALAMDPQQRLLLQTSWEAVERAGIDPLSLKGSDTGVFT
GAMTQDYGPRLHEPDSSGTVDGYMLTGNAGSVMSGRVAYVLGTEGPAVTVDTACSSSLVA
LHWAAQALRQGECSMALAGGVTVMATPGMFVEFSRQRGLAPDGRCKAFAAGADGTGWAEG
VGMVLVERLSDAQRLGHPILAVVRSSAVNQDGASNGLTAPNGPSQQRVIRQALSTAGLTT
ADVDAVEAHGTGTNLGDPIEAQALLATYGQDRPEGRPLLLGSLKSNIGHTQAAAGVAGVI
KMVMALRHGVLPATLHVDEPSPHVDWASGAVELLTEATAWPETDRPRRAAVSSFGISGTN
AHAILEQAPETDNAAEPVVRDGVLVPWVVSGRGVDGVRAQAAGLREWVLEHPQHSATDIG
FSLLSSRSLHRDRLVVLGSDRQVLVDGLAAAAEGAPWPGLVQSSGDVSLSRAVFVFPGQG
SQWVGMGRELYASSPVFRARLDECARALDPLVDWSLIDVVRGESGAPGLERVDVVQPVLW
AVMVSLAAVWESWGVVPAAVVGHSQGEIAAACVAGALSVEDAAQVVALRSRAVRAMAGDG
AMVSVALPAAEAEALTGDGVSLAAVNGPSSVVLSGDRSALTPVVEGLTAQGVRTKWVPVD
YASHSAHMERIRDELLEILSGIEPKTSRIPLYSTVSAARIDTSRMDASYWFDNIRGTVRF
HETVQALIADGLTAFVEVSPHPVLAMSVQDTLDQAEATGLSIGTLRRDQNEHETLLTAAA
ELFVAGLPIDWHTAAFADLDTRRVDLPTYAFQTERFWLEAGTAVAEAAVADGVEARFWEI
VERGDAGELVEALGVADEAGSADAWQPMLPALASWRRAQQARSAADSWRYRVTWKPRTGT
HPAALSGTWLVIAPGSPEHTDLADECVRALTDHGASVELISPDGRTPVDRTRWRDLLNTA
LTARPDGLAGVVSLSAVSADTEAGSPATGSAVVPRSAAAVLGLVQALGDLEVSAPLWCLT
RGAVSVGRSDALRSPEQALVWGLGRAAALEHPDRWGGLIDLPENADQRCWERICSVLSGA
DAEDQVAIRSSGVFLRRLVPAPLPARATGPGWALDGGTVLITGGTGALGGHIARWVIESG
ARRLLLVSRSGPAAPGAGELAAELESAGAEVEIVAADIADRDAVAGILDGIPAEQPLIAV
VHTGGANAMGPLDELDTASFAEVIRAKVGGAAVLDELLVDQPQIRSFVLFSSGAGIWGSG
GQGAYSAGNAYLDALAEQRRAAGLPATRVAWGPWADGGMAEGELGRELARSGLAPMRPET
AVGALARAVEHDETAVTVVDADWERFYPSFAIARPRPLLHDIPQVAAVLVAGESAAGADL
PSPLAARLADRSPVERRKTILELVRAQAAAVLGHTGTDRIVAGRPFRELGFDSLTAVELR
NRLNTATGLKLSSTAAFDHPTPEVITGHILSGLELGGESPDDEAAALGSVPHSHDEPLAV
VGMACRLPGGTNSPERLWQLLMERGDVISELPTDRGWDIEGLYDPDPDRPGTSYTRAGGF
LYDAAEFDAEFFGISPREALAMDPQQRLLLQVGWEAVERAGIDPLSLHGSRTGVFVGAMT
QDYGPRMHVADASDNVEGYLLTGTTSSVASGRLAYVLGAEGPAVTVDTACSSSLVALHLA
GQALRQGECSMALAGGVTVMATPGTFVEMSRQRGLAVDGRCKAFAAAADGFGPAEGVGMV
LLERLSDAQRLGHPVLAVIRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAADLSSADVD
VVEAHGTGTALGDPIEAQALLATYGQGRTDDRPLWLGSLKSNIGHTQAAAGITGVIKMVM
ALRHGVLPATLHVDEPTPHVDWTAGRVQLLSDQVVWPEVDRPRRAAVSSFGISGTNAHAI
LEQAPEEQTPETDNAAEPVAHDGALVPWVVSGRGEEALRAQAARLHGWVFERPEERLVDI
GHSLVTSRSAFDDRLVVLGSDRDALLNGLAAAARGEIRPGIARSTERSGGGVAFLFTGQG
AQRLGMGRELAECFPVFAVALDEVCAHVDVRLERPLRDVLFAEPGSEAAALLDETAFTQV
ALFAVEVALYRLVESWSLTPDYLLGHSIGGLAAAYVSGVLSLEDAAEVVVARGRLMQALP
KGGAMVSLQAAEDEVVESLGGRVSIAAVNGPQAVVISGDEDAVTAVAEEWRARGRKVKRL
TVSHAFHSVLMEPMLAEFEQVLSRVTLNPPRIPIISDSTGLPLTAEQATSPAYWVGHVRQ
PVLFHQAVTYLADQGVNSFLELGPDGVLSAMVQHSAPDAAQATPLLRSDREETETALTAL
AELYVNGADVDWTALFEGAGRIDLPTYAFQHQRFWLAAGTETQPAPEEADPKEARFWAAV
ERSDAGELADAFAEVGLDAPEQAWESVLPALSTWRQIQRTQAAADSWRYRVVWKPAPGAQ
PAAPAALTGTWLLITSAAPECLAVVDECAGALARRGAVVRVVRSGTDDSADRAAWHTTVA
GVLAETGEPVGVVSLLGLADEPHPHFPEVPQGAAGLLALTQALGDAGLRAPLWCLTQGAV
SVDGSDLLRSPSQALLWGLGRVVALEHPELWGGLVDLPATPDSRCWEQVCATLAGAGAGA
GAGASAEDQVAVRSSGIFVRRLVPAPLPARATGPGWAPDGGTVMITGGTGALGGHVARWV
AEYGAQHILLLSRSGPDAPGARELMAELEAAGNQVDLVACDIADREAVAGVLAGIPEEHP
LTSVVHTAGASAPVPLTELDTASFAEVIRAKVGGAAVLDELLVDQPQIRSFVLFSSGAGI
WGSGGQGAYSAGNAYLDALAEQRRAAGLPPRRWPGAPWADGGMAEGELGRELDRRGLASM
APASAVHALRRALEHDETAVTVVDADWERFYPAFAIARPRPLLHDIPQVAAALAAVDQPA
SAEGASGFAGQLAGLSDTEQYKTVLELVRVQAASVVGHLTPERITAERAFRDVGFDSLTA
VELRNRLNNATGLVLPTTTIFDHPTPVLLAEHLQRELTSTTPEIFATLAKLENELQLVAG
NRALSEDVLARLSKIVRSSEPANPAEGEQDEIADLMSASDDEVFGLLRDEFGIS
selected fasta
>polyketide synthase [type I polyketide synthase]
GTGTCAGCCACAGGTCGGATAGCTGTCGTTGGCATGTCCTGCCGACTTCCAGGGGCCCTG
GATCTCGGAGAATTCTGGGATTTGCTGATGTCCTCGGGCAGCGGTGTGGGGCTGCCCGGT
TCGGACCGTTCGCGTCGACTCGATGACTCCCATGAGCCCCGCAGGGCGGGCTATCTCCAG
CAGGTCGACCTGTTCGACGCGTCCTTCTTCGGCCTGGGGCCACAGGAAGCTACGGCGATG
GACCCCCGGCAGCGGCTGATCCTCGAACTGAGCTGGGAGGCGCTGGAGAACGCCGGGATA
TCCCCGGCCGGACTGGCGGGCAGCTCCGTCGGGGTGTTCCTGGGCGCGTCCGGCGACGAC
TACCCCGGCGCGGGAACCGTCGCGGACGCCAACCCCTATCTGGCTGCGGGCACCAACCGG
GCGGTCATCGCCAACCGGGTGTCTCACGCACTGGACCTCACTGGTCCGAGCCTGCTGGTC
GACACCGCGCAGTCCTCCTCCCTGGTCGCGGTGCACATGGCCTGCGAAAGCATCCGCCGG
GGTGAGTGCACCACGGCGATCGTCGGGGGAGTCAATCTGAACCTCTCCTCGCGCCGCATC
CACATGCTGGAATCCCTGGGGGTCGTTTCTCCGGACGGTGAGTGCTTCACCTTCGACGCC
CGCGCCAACGGCTTCGTGCCCGGCGAAGGCGGCGGTGTCCTGGTCTTGAAGGACCTGTCC
GCTGCACTCGCCGACGGGGGTCAGGTGCACGCCGTCATTCGAGGTACCGCCCTGAACCAC
GACGGTGCCACCTTTGGACTCTCCTCGCCGAGCCCCGCCGCACAGGAAGCGGTGATCAGA
CAGGCGCACCGCGCTGCTGATGTCCTTCCCGGCGATGTCCGGTTCGTTGAGTTGCATGGA
ACGGGCACTCAGGCGGGAGATGCCACCGAGGCCACCGCACTCGGCGCGGCCTTCGCCGGT
GACTCCCCGCGGGAGTCCCCGCTGCTGGTCGGGTCGGTGAAGACGAACATCGGCCATCTG
GACGCCGCCTCGGGCGCGGTCGGGCTGATCAAGGCAGTGCTCAGCCTGACGAACCGGAAG
CTCCCGCCGAGTCGCAACTTCGCTGAGCCGAACCCCGCCATCGATCTCCCCGCCCTGGGC
CTTGAGGTCGCGACCTCGGTCCGAGACCTGGCCGGCGACAGCGGAGAGTCCCCTGTTCAG
GCGGGTGTCTCTTCGTTCGGCATGGGCGGGGCGAACTGCCATGTCGTGGTGTCGGACGCA
CTGGACCTTGACACGTCGGCACCACGACCGAGCACGGAAACCGCATCTGACACACCGCCG
GAGACCTCGGACGGTGTTCTGGTGCCGTGGGTGGTTTCGGGCCGTGGTGTCGATGGTGTT
CGGGCGCAGGCGGCGCGGTTGCGGGAGTGGGTGTTGGAGCGGTCTGCGGACCGTCCGGTG
GATGTGGGCTTCTCGTTGTTGTCGTCGCGGTCGTTGCATCGGGATCGGTTGGTGGTGCTG
GGTTCTGATCGTCAGGTGTTGGTGGATGGGCTGGCGGCGTTTGTTGAGGGTGCGCCGTGG
CCGGGTGTGGTGGGTGGGTCGGGTGGTGGTGTGGTTGCTGATCGGGCTGTGTTTGTGTTC
CCGGGGCAGGGGTCGCAGTGGGTGGGGATGGGGCGTGAGTTGTATGCCTCTTCGCCCGTG
TTTCGGGCGCGGTTGGATGAGTGTGCGGCTGCGTTGGATCCGTTGGTGGACTGGTCGCTG
ATTGATGTGGTGCGGGGTGGGTCCGGGGCTCCTGGTCTGGAGCGGGTGGATGTGGTTCAG
CCGGTGTTGTGGGCGGTGATGGTGTCGCTGGCGGCGGTGTGGGAGTCGTGGGGTGTTGTT
CCGGCTGCTGTGGTGGGTCATTCGCAGGGGGAGATTGCCGCTGCGTGTGTGGCGGGGGCG
TTGTCGGTGGTGGATGCGGCGCGGGTTGTGGCGTTGCGGAGTCGGGCGCTGCGGGCGATG
GCGGGTGACGGTGCGATGGTGTCGGTCGCGCTCCCCGTTGCTGAGGCTGAGGCGTTGACC
GGGGACGGTGTGTCGCTGGCGGCTGTCAACGGACCCTCGTCCGTGGTCCTGTCGGGGGAC
CGGTCTGCCCTCACTCCCGTGGTGGAGCGACTGAGCGCCGAAGGTGTTCGGACGAAGTGG
GTGCCGGTGGACTACGCGTCTCACTCGGCCCATATGGAGCGCATCCACGACGAGCTGTTG
GAGATCCTGTCCGGGATCGTGCCCAAGACCTCCCGTATCCCGCTCTACTCCACGGTGTCG
GCGGAGGTCATCGACACGTCGGTCATGGATGCCGGCTACTGGTTCGACAACATCCGGGGC
ACCGTCCGCTTCCACGAGACCGTTCAAGCCCTGATCGCCGACGGCCTCACCGCCTTCGTG
GAGATATCCCCGCACCCCGTCCTGGCGATGAGCGTTCAGGACACCCTCGACCAGGCCGAA
GCCACCGGTCTGTCCATCGGAACGCTGCGCCGCGACGAGAACGAAGAGAAGTCCCTGCTC
ACCGCAGCGGCTGAACTCTTCGTCGCCGGCCTCCCCATTGACTGGAACACGGCCGCCTTC
GCCGACCTCGACACCCGCCAGGTCGACCTGCCCACCTATGCCTTCCAGCGTCGGCCCTAC
TGGCTGGAGACCGTCGCGCAGACAGTGCGGGTTGGTGCGCCTGCAGCCGCGCCCACCGAA
AGTCCTGAAGTCCCCGGCAGCCGATCGCCTCTGGCCGAGCGAGTGGCCGGACTTCCGCAG
GGCGCACGGCACCAGGCTGTAACGGACTTCGTCCGCGCGCACGCCGCCGCCGTGCTCGGT
CATACCGACCACTCCGATATCGACGTAGCGCTGACCTTCCGAGACCTAGGGTTCGACTCG
ATCAACGCGACCGAGTTCCGGCTTCGGCTCGGCGATGCAGCCGGGCTACGGCTCCCCGCC
ACTCTTGTGTTCGACCACCCGACGCCCGCGGTGGTGGTGGATTTCCTGCTGACCCGACTG
TTGGGCGGCGAAGCGGACTCCCTGCCCAGCACGCGAACGGCGGCTTCCGATCCTGATGAG
CCAGTGGCCATCGTGGGCATGGCCTGCCGCTTCCCGGGCGGAGTCAGCACACCGGAGCAG
TTGTGGCGGCTGGTCGCGGAGGGCGTTGATGCCGTCTCCGGTCTTCCCACTGACCGTGGC
TGGGACATTGAGTCGCTGTACCACCCGGATCCGGATCACCCGGGGACCTCGTACGCGAAC
GAGGGCGGCTTCCTGCATGAAGCCGGTGAGTTCGACGCGGGCTTCTTCGGGATCTCCCCG
CGTGAGGCGCTAGCGATGGACCCCCAGCAGCGGCTCCTGCTCCAGACCAGCTGGGAGGCA
GTGGAGCGGGCGGGCATAGACCCACTGTCGCTGAAGGGCAGCGACACCGGTGTGTTTACC
GGTGCCATGACACAGGACTACGGCCCTCGATTGCACGAGCCGGACAGCTCGGGCACCGTC
GATGGCTACATGCTGACCGGTAACGCCGGCAGTGTGATGTCCGGTCGGGTGGCGTATGTG
TTGGGGACTGAGGGTCCGGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTCGCG
CTGCATTGGGCGGCGCAGGCGTTGCGTCAGGGTGAGTGCTCGATGGCGTTGGCCGGTGGT
GTGACGGTGATGGCGACGCCGGGGATGTTTGTGGAGTTCAGTCGTCAGCGGGGGTTGGCG
CCGGATGGTCGGTGTAAGGCGTTCGCGGCCGGCGCTGATGGTACGGGTTGGGCTGAGGGT
GTTGGGATGGTGTTGGTGGAGCGGTTGTCGGACGCCCAGCGGCTCGGTCACCCGATTCTT
GCGGTGGTTCGTTCGAGTGCGGTGAATCAGGATGGTGCGAGTAATGGGTTGACGGCGCCG
AATGGTCCGTCGCAGCAGCGGGTGATCCGTCAGGCCCTGTCGACGGCCGGGCTGACGACC
GCCGATGTGGACGCGGTCGAAGCCCATGGCACGGGGACGAATCTGGGTGACCCGATCGAG
GCGCAGGCCCTGCTGGCGACCTATGGTCAGGACCGTCCCGAGGGCCGGCCGCTGTTGCTC
GGCTCGTTGAAGTCGAACATCGGGCACACGCAGGCTGCGGCCGGTGTGGCGGGTGTGATC
AAGATGGTGATGGCGCTGCGGCATGGTGTGTTGCCGGCGACGTTGCATGTGGATGAGCCG
TCGCCGCATGTCGATTGGGCGAGCGGCGCGGTCGAGCTGCTGACCGAGGCGACGGCCTGG
CCCGAGACGGACCGTCCGCGCCGGGCCGCGGTGTCGTCGTTCGGCATCAGCGGCACCAAC
GCCCACGCAATTCTGGAGCAGGCGCCGGAGACTGACAACGCTGCTGAGCCGGTAGTGCGT
GACGGTGTTCTGGTGCCGTGGGTTGTTTCAGGTCGTGGTGTTGATGGTGTTCGGGCGCAG
GCGGCGGGGTTGCGGGAGTGGGTGCTGGAGCACCCGCAGCACAGTGCGACGGATATCGGC
TTCTCGTTGTTGTCGTCGCGGTCGTTGCATCGGGACCGGTTGGTGGTGCTGGGTTCTGAT
CGTCAGGTGTTGGTGGATGGGCTGGCGGCGGCTGCCGAGGGGGCGCCGTGGCCGGGGTTG
GTTCAGTCGTCTGGGGATGTGTCGCTGAGCCGGGCTGTGTTCGTTTTCCCGGGTCAGGGG
TCGCAGTGGGTGGGGATGGGGCGGGAGTTGTACGCATCTTCGCCTGTGTTTCGGGCGCGG
TTGGACGAGTGCGCGCGGGCGTTGGATCCGTTGGTGGACTGGTCGCTGATCGATGTGGTG
CGGGGTGAGTCCGGGGCTCCTGGTCTGGAGCGGGTGGATGTGGTGCAGCCCGTCCTCTGG
GCCGTGATGGTCTCCCTGGCGGCGGTCTGGGAGTCATGGGGTGTGGTCCCGGCCGCTGTG
GTGGGTCACTCACAGGGTGAGATTGCCGCTGCGTGTGTGGCGGGGGCGCTGTCGGTGGAG
GATGCGGCGCAGGTTGTGGCGTTGCGGAGCCGTGCCGTGCGGGCGATGGCGGGTGACGGC
GCGATGGTGTCCGTCGCACTCCCTGCCGCTGAGGCCGAGGCGTTGACCGGGGACGGCGTG
TCGCTGGCCGCCGTCAATGGACCCTCGTCCGTCGTCCTCTCAGGGGACAGATCTGCCCTC
ACCCCCGTGGTGGAGGGACTGACTGCTCAGGGTGTGCGGACGAAGTGGGTGCCGGTGGAC
TACGCGTCCCACTCGGCCCATATGGAGCGCATCCGCGACGAGCTGCTGGAGATCCTGTCC
GGGATCGAGCCCAAGACCTCCCGTATCCCCCTCTACTCCACGGTGAGCGCTGCTCGTATC
GACACGTCGCGGATGGACGCCTCGTACTGGTTCGACAACATCCGGGGCACCGTCCGCTTC
CACGAGACCGTCCAGGCCCTGATCGCCGACGGACTGACCGCCTTCGTGGAGGTGTCTCCG
CACCCCGTTCTGGCGATGAGCGTTCAGGACACCCTCGACCAGGCCGAAGCCACCGGTCTG
TCCATCGGCACCCTCCGCCGAGACCAGAACGAGCACGAAACCCTCCTCACCGCAGCGGCT
GAACTCTTCGTCGCCGGCCTCCCCATCGACTGGCACACGGCCGCCTTCGCCGACCTCGAC
ACCCGCCGAGTCGACCTCCCCACCTATGCCTTCCAAACTGAGCGGTTCTGGCTGGAAGCC
GGCACAGCCGTTGCCGAGGCTGCTGTAGCCGATGGTGTGGAAGCACGTTTCTGGGAGATC
GTCGAGAGAGGTGACGCCGGTGAACTGGTCGAAGCCCTCGGTGTCGCGGACGAGGCCGGA
TCGGCCGATGCCTGGCAGCCGATGCTTCCCGCGCTGGCCTCCTGGAGGCGTGCTCAGCAG
GCCCGTTCGGCCGCGGACTCCTGGCGCTACCGCGTCACCTGGAAGCCCCGTACCGGCACC
CACCCCGCTGCCCTCTCCGGTACCTGGCTGGTCATCGCCCCTGGCTCGCCCGAGCACACC
GACCTCGCCGACGAATGTGTACGCGCACTGACGGACCACGGCGCCTCCGTCGAGCTGATC
AGCCCCGACGGCCGTACCCCGGTCGACCGGACGCGGTGGCGCGATCTGCTGAACACGGCG
CTGACGGCCCGCCCGGACGGTCTGGCCGGTGTGGTGTCGCTCTCCGCAGTGAGCGCGGAC
ACCGAGGCCGGATCTCCGGCGACCGGCTCCGCCGTCGTTCCACGGAGCGCGGCAGCCGTG
CTGGGTCTGGTCCAGGCGCTCGGTGACCTGGAGGTCTCTGCTCCACTGTGGTGCCTGACC
CGTGGCGCAGTGTCCGTGGGGCGCTCCGATGCTCTGCGGTCGCCTGAACAGGCGCTGGTC
TGGGGGCTGGGCCGAGCAGCCGCGCTGGAACACCCCGATCGCTGGGGCGGCTTGATCGAC
CTTCCGGAGAACGCCGACCAGCGCTGCTGGGAGCGGATCTGCTCCGTGTTGTCCGGTGCC
GATGCCGAGGACCAGGTGGCGATCCGGTCCTCGGGAGTCTTCCTGCGCCGGCTTGTGCCT
GCTCCTCTGCCGGCCCGGGCCACCGGCCCCGGATGGGCCCTGGACGGCGGTACGGTACTG
ATCACTGGCGGTACGGGTGCGCTGGGCGGGCATATCGCCCGCTGGGTCATCGAGAGCGGC
GCCCGACGGCTGTTGCTGGTCAGCCGGAGCGGTCCCGCTGCGCCCGGCGCCGGTGAGCTG
GCGGCCGAGCTGGAGAGCGCGGGTGCCGAAGTCGAGATCGTCGCCGCTGATATCGCCGAC
CGGGACGCAGTGGCCGGGATTCTCGACGGGATCCCGGCGGAGCAGCCGCTCATCGCGGTG
GTGCACACCGGCGGCGCGAACGCCATGGGACCGCTGGACGAACTCGACACGGCCTCGTTC
GCCGAGGTGATCAGGGCGAAGGTCGGCGGTGCCGCCGTGCTGGACGAGCTGCTGGTGGAT
CAGCCGCAGATACGTTCCTTCGTACTGTTTTCGTCCGGTGCCGGGATCTGGGGTAGCGGC
GGCCAAGGCGCGTACAGCGCCGGGAACGCCTATCTGGACGCGCTGGCGGAGCAGCGCCGT
GCGGCCGGGCTGCCGGCCACGCGGGTGGCCTGGGGCCCCTGGGCCGACGGCGGCATGGCC
GAGGGAGAGCTGGGACGGGAGCTGGCCCGGAGCGGACTGGCGCCGATGCGGCCGGAGACG
GCCGTCGGTGCACTGGCGCGCGCGGTGGAGCACGACGAGACGGCGGTGACGGTGGTCGAC
GCCGACTGGGAGCGCTTCTACCCGTCCTTCGCCATCGCCCGCCCCCGGCCCTTGCTGCAT
GACATTCCCCAGGTCGCGGCGGTACTGGTGGCCGGCGAGAGCGCAGCAGGCGCCGATCTC
CCGTCCCCCCTTGCCGCCCGGCTCGCGGACCGTTCCCCGGTCGAGCGGCGCAAGACCATA
CTGGAGCTGGTACGCGCCCAGGCGGCGGCGGTACTCGGCCACACCGGCACCGACCGTATC
GTCGCCGGACGCCCCTTCCGCGAGCTGGGCTTTGACTCGCTGACCGCCGTCGAGCTGCGC
AACCGGCTCAACACGGCCACCGGACTGAAGTTGTCCAGCACAGCGGCCTTCGACCACCCG
ACGCCCGAGGTGATCACCGGACACATTCTGAGCGGTCTGGAGCTGGGCGGAGAGAGCCCT
GACGACGAGGCGGCAGCGCTGGGATCCGTACCCCACTCCCACGACGAGCCGCTGGCCGTG
GTGGGCATGGCCTGCCGTCTGCCCGGTGGTACGAACTCGCCGGAGCGGCTGTGGCAGCTC
CTCATGGAGCGCGGCGATGTGATCTCCGAGCTGCCCACGGACCGTGGTTGGGACATCGAG
GGGCTCTACGACCCGGATCCGGACCGACCGGGCACCTCGTACACACGGGCCGGTGGCTTC
CTGTACGACGCCGCCGAGTTCGACGCCGAGTTCTTCGGGATTTCGCCGCGTGAGGCGCTG
GCGATGGACCCGCAACAGCGGCTGCTATTGCAGGTCGGCTGGGAGGCCGTGGAGCGCGCC
GGAATCGACCCGCTGTCTCTGCACGGCAGCCGGACCGGCGTCTTCGTCGGCGCGATGACG
CAGGACTACGGGCCGCGTATGCATGTCGCCGACGCGTCCGACAACGTAGAGGGCTATCTG
CTGACCGGTACCACGAGCAGTGTGGCATCCGGCCGACTGGCGTATGTGCTGGGTGCGGAA
GGTCCGGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGCTGGTCGCGCTGCATCTGGCG
GGCCAGGCCCTGCGTCAGGGCGAGTGCTCCATGGCGCTCGCCGGTGGCGTCACCGTGATG
GCGACGCCGGGCACGTTCGTCGAGATGAGTCGTCAGCGCGGTCTGGCGGTGGACGGCCGG
TGCAAGGCGTTCGCCGCCGCGGCGGATGGATTCGGACCGGCCGAGGGTGTCGGCATGGTC
CTCCTGGAGCGGCTGTCGGATGCCCAACGCCTCGGTCACCCCGTGCTGGCGGTGATCCGT
TCGAGTGCGGTGAATCAGGATGGTGCGAGTAATGGTCTGACGGCGCCGAATGGTCCGTCG
CAGCAGCGGGTGATCCGTCAGGCTCTGGCGGCTGCGGATCTGTCGTCCGCCGATGTGGAT
GTGGTGGAGGCGCACGGTACGGGTACGGCGCTGGGCGATCCGATCGAGGCGCAGGCACTG
CTGGCCACGTACGGCCAGGGCAGGACGGACGACCGTCCGCTCTGGCTCGGCTCGCTGAAG
TCGAACATCGGACACACCCAGGCGGCTGCCGGTATTACCGGTGTCATCAAGATGGTGATG
GCGCTGCGGCACGGCGTCCTCCCGGCGACCCTCCATGTCGATGAGCCGACACCACACGTC
GACTGGACGGCCGGCCGCGTACAACTCCTCTCCGACCAGGTGGTCTGGCCCGAAGTGGAC
CGGCCACGTCGTGCTGCTGTGTCGTCGTTCGGTATCAGTGGCACCAACGCGCACGCGATC
CTGGAGCAGGCCCCCGAGGAGCAGACGCCGGAGACTGACAACGCCGCTGAACCCGTCGCT
CATGACGGCGCCCTGGTGCCATGGGTGGTCTCGGGCCGTGGTGAGGAAGCATTGCGGGCA
CAGGCCGCACGGTTGCACGGGTGGGTGTTCGAGCGCCCTGAGGAGCGTCTGGTCGACATC
GGTCATTCGCTGGTGACGTCGCGGTCGGCCTTCGACGATCGGCTCGTTGTTCTCGGTTCG
GATCGGGATGCGCTGTTGAATGGTCTGGCGGCGGCTGCGCGGGGCGAGATCCGGCCCGGA
ATCGCCCGGAGCACGGAACGATCCGGTGGTGGTGTGGCGTTCCTGTTCACGGGGCAGGGT
GCGCAGCGGCTGGGGATGGGTCGTGAACTCGCGGAGTGTTTCCCGGTGTTCGCTGTGGCT
TTGGACGAGGTCTGTGCGCATGTGGATGTTCGTCTGGAGCGTCCGTTGCGTGACGTGCTC
TTCGCCGAGCCGGGTAGTGAGGCTGCGGCGCTGTTGGATGAGACGGCGTTCACGCAGGTG
GCGTTGTTTGCCGTTGAGGTTGCGCTGTATCGGTTGGTGGAGTCGTGGTCGCTGACGCCG
GACTATCTCCTGGGTCACTCGATTGGTGGTCTGGCCGCGGCGTATGTGTCGGGTGTGTTG
TCGTTGGAAGATGCGGCCGAGGTCGTGGTGGCTCGGGGTCGGTTGATGCAGGCCCTGCCC
AAGGGCGGAGCCATGGTCTCCCTCCAGGCCGCTGAGGACGAGGTTGTGGAGTCGCTGGGC
GGCCGGGTGTCGATCGCCGCGGTGAATGGTCCGCAGGCGGTCGTCATCTCGGGCGATGAG
GACGCTGTCACGGCGGTGGCGGAGGAGTGGCGGGCCCGGGGTCGGAAGGTGAAGCGCCTC
ACGGTCAGTCATGCTTTCCATTCGGTGTTGATGGAGCCGATGCTCGCCGAGTTTGAGCAG
GTCCTGTCCCGGGTCACGTTGAACCCGCCGCGGATTCCGATAATCTCCGACTCCACTGGC
CTGCCTCTCACGGCGGAGCAGGCCACCTCTCCCGCGTACTGGGTCGGGCATGTCCGTCAG
CCCGTCCTGTTCCACCAGGCGGTGACCTATCTGGCCGACCAAGGCGTGAACAGCTTCCTG
GAACTGGGCCCCGATGGCGTACTCAGCGCCATGGTCCAGCACAGCGCCCCGGACGCAGCA
CAGGCCACCCCGCTGCTCCGCTCGGACCGGGAGGAGACGGAAACGGCGCTGACCGCGCTG
GCCGAGTTGTATGTCAACGGCGCGGATGTCGACTGGACCGCACTCTTCGAAGGCGCCGGC
CGGATCGACCTGCCGACCTATGCCTTCCAGCACCAGCGCTTCTGGCTGGCGGCCGGAACG
GAGACACAGCCGGCACCCGAGGAAGCGGACCCCAAGGAGGCCCGGTTCTGGGCTGCCGTC
GAACGTTCCGACGCCGGTGAACTGGCCGATGCCTTCGCTGAGGTGGGCCTGGACGCGCCG
GAGCAGGCTTGGGAGTCCGTCCTGCCCGCGCTCTCCACCTGGCGTCAGATACAGCGGACG
CAGGCCGCCGCCGACTCCTGGCGTTACCGGGTCGTCTGGAAGCCCGCCCCCGGTGCCCAG
CCCGCAGCGCCAGCCGCGCTGACCGGCACCTGGCTGCTGATCACCTCGGCGGCCCCGGAG
TGTCTGGCCGTGGTCGACGAGTGTGCCGGCGCCCTGGCGCGCCGGGGTGCGGTCGTACGG
GTGGTTCGGTCCGGCACGGACGACTCTGCCGACCGTGCCGCCTGGCACACCACCGTAGCG
GGCGTGCTCGCGGAGACCGGCGAACCCGTCGGGGTGGTCTCGCTGTTGGGGTTGGCGGAC
GAGCCGCACCCTCACTTCCCCGAGGTGCCCCAGGGTGCCGCCGGGCTACTGGCCCTGACA
CAGGCACTCGGCGACGCGGGCCTGCGGGCTCCGCTGTGGTGCCTGACCCAGGGCGCCGTG
AGCGTCGACGGCTCCGACCTGCTGCGATCGCCGTCACAGGCACTGCTCTGGGGCCTGGGC
CGGGTCGTCGCCCTGGAACACCCCGAACTCTGGGGCGGTCTGGTCGACCTTCCCGCGACC
CCCGATTCGCGCTGCTGGGAACAGGTCTGTGCCACGCTGGCTGGTGCTGGTGCTGGTGCT
GGTGCTGGTGCAAGTGCCGAGGATCAGGTGGCGGTCCGGTCCTCGGGAATCTTCGTACGC
CGGCTTGTGCCCGCTCCTCTGCCGGCCCGGGCCACCGGCCCCGGATGGGCCCCGGACGGC
GGTACGGTAATGATCACTGGCGGTACGGGTGCCCTGGGTGGCCATGTCGCCCGCTGGGTG
GCCGAGTACGGTGCGCAGCACATTCTGCTGCTCAGCCGCAGCGGCCCCGACGCCCCCGGC
GCTCGGGAACTGATGGCCGAGCTGGAGGCCGCCGGGAACCAGGTTGACCTGGTTGCCTGC
GATATCGCCGACCGTGAAGCGGTGGCCGGGGTCCTCGCCGGAATCCCCGAGGAACACCCT
CTCACCTCGGTGGTGCACACAGCCGGCGCCAGCGCGCCGGTCCCGCTCACGGAGCTGGAC
ACGGCCTCGTTCGCCGAGGTGATCAGGGCGAAGGTCGGCGGTGCCGCCGTGCTGGACGAG
CTGCTGGTGGATCAGCCGCAGATACGTTCCTTCGTACTGTTTTCGTCGGGTGCCGGGATC
TGGGGTAGCGGCGGCCAGGGTGCGTACAGCGCCGGGAACGCCTATCTGGACGCGCTGGCG
GAGCAGCGCCGTGCGGCCGGGCTGCCGCCACGGCGGTGGCCTGGGGCGCCCTGGGCCGAC
GGCGGCATGGCCGAGGGAGAGCTGGGACGGGAACTCGACCGGCGGGGCCTGGCGTCGATG
GCGCCCGCGTCGGCGGTGCACGCCCTGCGCCGGGCCCTGGAGCACGACGAGACGGCGGTG
ACGGTTGTTGACGCCGACTGGGAGCGCTTCTATCCGGCCTTCGCGATCGCCCGCCCCCGG
CCCCTGTTGCATGACATTCCCCAGGTCGCGGCAGCGCTCGCAGCCGTAGACCAGCCCGCT
TCCGCCGAGGGCGCGTCCGGATTCGCCGGTCAGCTCGCCGGTCTGTCCGACACGGAGCAG
TACAAGACGGTGCTGGAGTTGGTCCGGGTCCAGGCGGCCTCGGTAGTGGGGCACCTGACT
CCGGAGCGCATCACCGCCGAACGGGCCTTCCGGGACGTGGGATTCGACTCCCTGACGGCG
GTGGAGCTGCGGAACCGGCTCAACAACGCCACCGGTCTGGTGCTGCCCACAACAACGATC
TTCGATCACCCCACACCGGTCCTGCTCGCCGAGCATCTGCAACGGGAGCTGACCAGTACC
ACCCCCGAGATTTTTGCGACCCTGGCCAAGCTGGAGAACGAGTTGCAACTCGTCGCGGGA
AACCGGGCATTGTCGGAAGACGTGCTGGCTCGGCTGTCGAAAATAGTCAGGTCGTCCGAA
CCTGCGAATCCCGCTGAGGGCGAGCAGGACGAAATTGCCGATCTCATGTCGGCGAGCGAC
GACGAAGTCTTTGGACTTCTCAGGGATGAGTTCGGTATCTCCTGA
[0] KSQ6..367
[0] AT537..851
[0] methylmalonyl-CoA725..729
[0] ACP927..997
[1] KS1019..1398
[1] AT1553..1867
[1] methylmalonyl-CoA1741..1745
[1] KR2197..2377
[1] ACP2480..2550
[2] KS2576..2954
[2] AT3114..3430
[2] malonyl-CoA3304..3308
[2] KR3761..3941
[2] ACP4044..4114
[0] KSQ16..1101
[0] AT1609..2553
[0] methylmalonyl-CoA2173..2187
[0] ACP2779..2991
[1] KS3055..4194
[1] AT4657..5601
[1] methylmalonyl-CoA5221..5235
[1] KR6589..7131
[1] ACP7438..7650
[2] KS7726..8862
[2] AT9340..10290
[2] malonyl-CoA9910..9924
[2] KR11281..11823
[2] ACP12130..12342

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [535-660]  G3DSA:3.40.366.10 [725-842]  G3DSA:3.40.366.10 [1551-1676]  G3DSA:3.40.366.10 [1741-1858]  G3DSA:3.40.366.10 [3105-3239]  G3DSA:3.40.366.10 [3304-3419]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [3761-3928]  2.29999999999998e-55 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [2508-2523]  PS00012 [4072-4087]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [920-1036]  4.00000300869883e-27 SSF47336 [2473-2592]  1.60000240695997e-25 SSF47336 [4036-4131]  7.89999609889417e-21 SSF47336
SSF47336   ACP_like
 [927-997]  PS50075 [2480-2550]  PS50075 [4044-4114]  PS50075
PS50075   ACP_DOMAIN
 [925-1000]  1.09999999999999e-61 G3DSA:1.10.1200.10 [2477-2551]  1.09999999999999e-61 G3DSA:1.10.1200.10 [4043-4118]  1.09999999999999e-61 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [930-996]  9.40000000000003e-11 PF00550 [2483-2549]  4.2e-10 PF00550 [4052-4113]  2e-11 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2197-2377]  1.29999999999998e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [6-242]  2.39999999999997e-74 PF00109 [1019-1272]  1e-99 PF00109 [2576-2828]  1.39999999999997e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [250-367]  8.89999999999994e-37 PF02801 [1280-1398]  1.09999999999999e-47 PF02801 [2836-2954]  1.80000000000002e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [537-851]  1.79999999999997e-107 PF00698 [1553-1867]  1e-107 PF00698 [3114-3430]  2.59999999999998e-63 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [535-834]  8.99992502689852e-73 SSF52151 [1551-1850]  3.10001307370203e-73 SSF52151 [3112-3421]  7.6999848053369e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [662-724]  1.39999892049878e-16 SSF55048 [1678-1740]  2.70000183580794e-16 SSF55048 [3241-3303]  2.90000354677981e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [7-254]  G3DSA:3.40.47.10 [255-420]  G3DSA:3.40.47.10 [1019-1283]  G3DSA:3.40.47.10 [1286-1451]  G3DSA:3.40.47.10 [2579-2840]  G3DSA:3.40.47.10 [2842-3008]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-364]  4.99996518094122e-78 SSF53901 [1012-1450]  1.09999184471405e-102 SSF53901 [2568-3006]  1.19999063421924e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2194-2416]  2.1e-63 G3DSA:3.40.50.720 [3759-3983]  2.1e-63 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1185-1201]  PS00606 [2741-2757]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [539-833]  3.699978135861e-128 SM00827 [1555-1849]  4.9000533180621e-130 SM00827 [3115-3410]  3.10001307370203e-114 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [928-1000]  1.29999924468179e-27 SM00823 [2481-2553]  1.60000240695997e-31 SM00823 [4045-4117]  4.00000300869883e-32 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [7-422]  SM00825 [1022-1450]  SM00825 [2578-3006]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2197-2377]  1.90000694315261e-47 SM00822 [3761-3941]  3.80000697093588e-47 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit
first first   Halsto_00020 Halsto_00020