close all open/close all

CDS information : Halsto_00020


close this sectionLocation

Organism
StrainHC34
Entry nameHalstoctacosanolide
Contig
Start / Stop / Direction13,667 / 35,002 / + [in whole cluster]
13,667 / 35,002 / + [in contig]
Location13667..35002 [in whole cluster]
13667..35002 [in contig]
TypeCDS
Length21,336 bp (7,111 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)hlsB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16568718] The complete biosynthetic gene cluster of the 28-membered polyketide macrolactones, halstoctacosanolides, from Streptomyces halstedii HC34. (J Antibiot (Tokyo). , 2006)

close this sectionPKS/NRPS Module

3 malonyl-CoA
4 methylmalonyl-CoA
5 methylmalonyl-CoA
6 malonyl-CoA
KS34..412
AT569..886
KR1204..1384
ACP1485..1555
KS1580..1956
AT2115..2429
DH2480..2648
KR2977..3156
ACP3260..3330
KS3354..3731
AT3888..4202
DH4253..4420
ER4787..5105
KR5114..5293
ACP5397..5467
KS5490..5865
AT6023..6339
KR6667..6843
ACP6947..7017

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MADEEKLQYFLRKVTVDLRESRHRVKELEGRWAEPLAVVGMACRFPGGVNSPEQLWDFVL
DGRDGISGFPTERGWDLDSLYHPDPDHPGTSYASEGGFLHDAGEFDPAFFGISPREALAM
EPQQRLLLQTSWEAIENAGIDPLSLKGSRTGVFVGAINQEYGPRLYDAAPDDNVEGYLLT
GTANSVVSGRVAYVLGTEGPALTVDTACSSSLVALHLAGQALRQDECSMALVGGVTVMTT
PTGFVEFSRQRGLAADGRCKSFAAAADGTGWAEGVGVLVVERLSDAQRLGHPVLAVIRSS
AVNQDGASNGLTAPNGPSQQRVIRQALAAADLSSADVDVVEAHGTGTALGDPIEAQALLA
TYGQNRPEDRPLRLGSIKSNIGHTQAAAGVAGVIKMVMALRHGVLPATLHVDGPTPHVDW
TSGAVELLADTTVWPEVDRPWRAAVSSFGISGTNAHTIIEQAPPVEVGAPEPAVKGNVLV
PWVVSGRGADALRAQAARLREWVLEHPEHRLVDVGHSLVVSRSAFEDRVVVLGSDRDALL
DGLAAAAQGEPGPGVVVGSSAGAGGGVAFLFTGQGAQRLGMGHELAARFPVFASALDEVC
VQLDAHLERPLREVLFAEPDTEAAALLDETVFTQAALFAVEVALYRLVESWSLTPDYLLG
HSVGGLAAAHVAGVLSLEDAAEVVVARGRLMQALPKGGAMVSLQASEDEVLESLSGLVSI
AAVNGPQAVVISGDEDAVTAVAEEWRARGRKVKRLTVSHAFHSALMEPMLATFEQVLSRV
TLNAPRIPVISDSTGLPLTPEQATSPAYWTGHVRNPVLFHQAVTHLTEQGVSAFLELGPD
GVLSAMTRTSVVGRDNTVVTPLLRADRDEPYSALTALAELYVNGTHVDFRAVQEGTGARL
VTLPTYAFRHQWFWLPTGTRPATGLDDDPFWGMVERGDAAELATIFAELGAEASAEEWGQ
LLPALTSWRQAQHARSTTDSWRYRITWKPRTGAPTTALSGTWLVITPTGYDETATECAAA
LRRHGAAVIPVTLDASTSETDRHAWHTRLEAEAAAMDGRLSGVVSLLGLAEAASDTSPAV
PHGVAGTLALVQALGDARIQAPLWCLTRGAVSTGRPDPLRSPLQAMIWGFGQVVGLEHPA
RWGGLADLPETVDDHGWDQLCSALADGAEDQVAVRPAGLLVRRLVPAAPAPVVATGADAR
AAGGTVLITGGTGALGGSIARWAAERGAQRLLLLSRSGDRAPGAEALLTELEAAGCPAEI
VGCDIADRDALAAVLAAIPAEHPLSAVIHTAGVLDDGVIDSLTPDRMATVLAAKHTGANN
LHELTADLPLSAFVLFSSAAATWGGVGGQGSYAAANAYLDALAEHRRDLGLPASSIAWGP
WADGGMAAAGDLGRALDRRGLQPMRPESATGLLSRVLDRGDTTVTIADVAWERFYPLLAT
ARPKPLLHDIPQIAALLAETGADTLPSELGSRLAGLPDEDRSRLVLEAVRSHAAAVLGHA
NTAGVEPNRAFRELGFDSLTAIEFCNRLIRTTGRPLPPTLVFDYPTPLAVADFILGELTG
TDPAGTPHRSDTVATASPDEPLAIVGMACRLPGGIRTPEQLWRLVAEGGDAVSGFPTDRG
WDIESLYHPDPDHPGTSYANEGGFLHEAGEFDAGFFGISPREALAMDPQQRLLLETSWEA
IESAGIDPLSLKGSSTGVFTGMSYHDYASPMTPVAEGLEGYLGTGNAGSVVSGRVAYVLG
TEGPAVTVDTACSSSLVALHWAAQALRQGECSMALAGGVTVMATPGMFVEFSRQRGLAPD
GRCKAFAAGADGTGWAEGVGMVLVERLSDAQRLGHSILAVVRSSAVNQDGASNGLTAPNG
PSQQRVIRQALSTAGLTTADVDAVEAHGTGTNLGDPIEAQALLATYGQDRPEGRPLLLGS
LKSNIGHTQAAAGVAGVIKMVMALRHGVLPATLHVDEPSPHVDWASGAVELLTEATAWPE
TGRPRRAAVSSFGISGTNAHTILEQAPAVSSGETDVPSRETGAEPTAWVISGRGKEGLIR
QAARLRDWANEQPEHSATDIGFSLLSSRSLHRDRLVVLGSDRQVLVDGLAAFVEGAPWPG
VVGGSGGGVVADRPVFVFPGQGSQWVGMGRELYASSPVFRARLDECAAALDPLVDWSLID
VVRGESGAPGLERVDVVQPVLWAVMVSLAAVWESWGVTPAAVVGHSQGEIAAACVAGALS
VEDAAQVVALRSRAVRGMAGDGAMVSVALPAAEAEALTGDGVSLAAVNGPSSVVLSGDRS
ALTPVVEGLTAQGVRTKWVPVDYASHSAHMDRIHDELLEILSGIEPKTSRIPLYSAVSAE
VIDTSRMDASYWFDNIRGTVRFHETVQALITDGLTAFVEVSPHPVLAMSVQDTLDQAEAT
GLSIGTLRRDENEHETLLTAAAELFVAGLPIDWNTAAYTGRSPQRVDLPTYAFARERFWL
RAASTTPTDARGLGLGTVGHPLLGAVVAMAEGDTTVLTGQISLRTHPWLADHAVLGSVLL
PGTAFLELAIRAADHVDCPQVEELILQAPLVLAEDRATDLQIQVGPADGDGIRAVDIYSR
PHPEDEPAAQERWTHHASGTLAPTTRTDTEDTGLSVWPPHDATPLPVTDIYPRLNRTGLE
YGPLFQGLRAAWRSGEEIYAEVALPDHQDDTAAPGDYGVHPALLDAALHAIGFHLGDRAT
DTEGQGWLPFSWTGAALHAVGASTLRVRLTPQGPDAVSLLAADTTGAPVISIDSLTLRPV
SAEQLRTRPGAGQNSLFALDWIPAGPVTGTEAATGPWAILDIAGIGGGETEALADALTVR
GVPTEVHPGLEAVPADGQNAPVDVLLPVLTTTAANEADALVSRLLGVLQEWLRRPEPTAS
RLIVVTRGAIATESDADITDLAAAAVWGLIRTAQLEHPDRFLLVDADQQALTDGSVVDAV
RGGEPQTAIRHGELLVPRLHRAMMEETGAPTEWATEGTVLITGGTGVLGAALARHLADRG
ARRLLLVSRQGARAAGSETLLADLRATGTLAEAVACDTTDRGALAELLAAVPDAYPLTAV
VHAAGVLDDAMLESLTPARIGAVLAPKATAAWNLHQLTAELPLSAFVLFSSATGTFGNAG
QAGYGAANAFLDALAQHRRAHGLSAISLGWGLWAEASAMTGHLAEQDRGRMHRKGADPLT
TEQGLALFDTATAQSRAHLLPVPLNTGALRDRAVPVTCPISSATWYGYRVAAPRAPARAA
GTGLAARLALLPLAERQRETLELVRANAAAVLGHAGADSVGAERAFRELGFDSLTSVELR
NRLNAATGLRLPATLVFDYPTPLAIALHLLDSMFPDGDDRTPSAPQQAALAAIDEPIAVV
GMACRYPGGVTSPEQLWQLVTKGEDAISGLPLDRGWDIEKLYDPDPANPGTSYTRHGGFL
HDAGEFDAGFFGISPREALAMDPQQRLLLETSWEAVESAGIDPLSLKGTDTGVFAGVMYH
DYATQLDAVSEDVGGYLGTGNASSVVSGRIAYAMGLEGPALTVDTACSSSLVALHLAAHA
LRQGECSMALAGGVTVMATPGTYVDLSRQRGLAVDGRCKAFAAAADGFGPAEGVGVLVVE
RISDAERLGHPILAVVRSSAVNQDGASNGLTAPNGPSQQRVIRQALASAALSTADVDVVE
AHGTGTALGDPIEAQALLATYGQGRPEGRPLRLGSLKSNIGHTQAAAGVAGVIKMVMALR
HGVLPATLHVDEPSPHVDWASGAVELLTEAMPWPEVGRPRRAAVSSFGISGTNAHIVVEQ
APESQIEVAASREETPAGSVAWVLSGRGEGALRAQAARLREWLLERPEDRPVDVGFSLLS
SRSVFEDRLVVLGSQREALLDGLAAAAEGAPWPGLVQSSGDVSLSRAVFVFPGQGSQWVG
MGRELYASSPVFRARLDECAAALDPLVEWSLIDVVRGESGAPGLERVDVVQPVLWAVMVS
LAAVWESWGVVPAAVVGHSQGEIAAACVAGALSVVDAARVVALRSRAVRGMAGDGAMVSV
ALPAAEAEALTGDGVSLAAVNGPSSVVLSGDRSALTPVVEGLTAQGVRTKWVPVDYASHS
AHMERIHDELLEILSGIEPKTSRIPLYSTVSAARIDTSRMDASYWFDNIRGTVRFHETVQ
TLIADGLTAFVEVSPHPVLAMSVQDTLDQAEANGLSIGTLRRDENEHETFLTAAAELFVA
GLPIDWNTAAFTGMSARRVDLPAYAFQRRHYWLDTASQTAGDAQELGLGAVDHPLLGASV
GVAESDLVVLTGHLSLRTHPWLADHAVLGSVLLPGTAFLELAVRAGDQVGRTRLEELVIQ
APLLLADDARDLQVVVGAADETGRSTVDIYSRPHADGDLDSERAWTHHAGGILAGGPVEE
FADADLSIWPPQNATPLDIADFYSQLDLAGYEYGPAFRGLRAAWRRGDEVFAEVELPESE
QDRAAEFGLHPALLDAALQAIGLTALGDSEPSEEAQPGKLPFSWNGVSLHASGAPMLRAR
LRPHGDEAISLVAADAHGEPVLSVDSLVLRALDPQQLNGARTAVQEDLFALEWAPLGELP
EQEAVELGDWALLDVPGLSGSVDGLLGGLLGRGIEPRVCGSVGELMVDGVEPDVVLLPVV
GGGGGGDAVDVVCGVLGVVREWLGLVGGVSRLVVVTWGAVSVGSGEGVGDVGGAGVWGLL
RSAQSEHPGRFVLVDVEGVEGVGWGGLVDGVVCGEGQVVVRGGGLLVPRLVRAGGGGLVI
PETFTGGVSGVGSAGVGVESSGEVLGSSVGGVGSGWCVGVGVGSGVGTLEGLGVVSAGAG
AGVGVGVGSGVGGGLGVGEVRVAVRAAGVNFRDVLIGLGVYPGEALLGSEGAGVVVGVGE
GVVNVGVGDRVMGLFLGGFGPEVVVDARMVVRLPVGWSFVEGATVPVVFLTAWYGLVDLA
GVRAGERLLVHAAAGGVGMAAVQLARHWGVEVFGTASEGKWEVLRGLGLDDAHIASSRDL
GFVEKFGRGSSGNGGGVDVVLNSLVGEFVDGSLGLLGEGGRFVEMGKLDVRDAGVVGELW
SGVWYRNFDLVEAGLDRIQEMLCELVGLFDVGVLEALPVRCWDVREVVDALRFVQQARHV
GKVVLRVPGGWGSGTVVVSGGTGVLGRAVVRYLVGCGVGRLLLLSRSGAAGEGVAGLVGE
LEGLGVVVDVVACDVGDREALAGVLGGVSGEFPVTGVVHLAGVLDDGMVESLSEGQVRRV
FAGKVDGLVNLDVLTRGMPVEGFVVFSSAAGVFGNAGQGNYAAANACVDAVVARRRVEGL
PGVSLAWGLWSEASGMTGHLDAGDHDRMNRAGLAGFSTDHGLALLESALALPHAQLLPIR
LDRARLQARADVGDVHPLLRGLVRSRSRRAASAVGIGVGGLGGRLVGLVEGERRRVVLDL
VRSHAATVLGHGDVAGVGAGRAFRELGFDSLTAVELRNRLNTATGVRLPATLVFDYPTPT
ELADYLLVQMVGESGAADSVQVPISVSSEEPLAVVGMACRFPGGVGSPNELWDFVLAGGD
GISGLPVDRGWDVAGLFDPDPEREGTSYTREGGFLHDAAEFDPGFFGISPREALAMDPQQ
RLLLETSWEAVENAGIDPLSLKGTSTGVFAGVTYHDHALRLQSISGTPDGLLGTGSSASV
VSGRVAYVLGLEGPALTVDTACSSSLVALHLAGQALRQGECSMALAGGVTVMATPGTFVD
FSRQRGLAADGRCKAFDVSADGFGPAEGVGMLVLERLSDAQRLGHPVLAVIRGSAVNQDG
ASNGLTAPNGPSQQRVIRQALASAGLSTMDIDAVEAHGTGTALGDPIEAQALLATYGQDR
PEDRPLRLGSIKSNIGHTQAAAGVAGVIKMVLAMQHGVLPPTLHVNEPTPHVDWASGAVE
LLTEATAWPETGKPRRAAVSSFGISGTNAHTIIEQAPQVEVGALEPAVKGDVLVPWVVSG
RGADALRGQAARLREWALKHPEERLIDVGHSLVMSRSAFEDRAVVLGSDREALLDGLAAA
AQGEPWPGVVQGSSVGSGGGVAFLFTGQGAQRVGMGRELSARFPVFASALDEVCVQLDAH
LERPLREVLFAEPDTEAAALLDETAFTQAALFAIEVALYRLVESWSLTPDYLLGHSIGGL
AAAHVSGVLSLEDAAEVVAARGRLMQALPKGGAMVSLQASEDEVVESLDGRVSIAAVNGP
QAVVISGDEDAVTAVADEWRARGRKVKRLTVSHAFHSVLMEPMLAEFEQVLSRVTLNAPR
IPVISDSTGLPLTVEQATSPAYWTGHVRNPVLFHQAVTHLTGQGVNSFLELGPDGVLSAM
TRTSLADDSDITVVPLLRRDREESEAALTALAELYVNGAVVEWSAVFGGGEAVRRVDLPT
YAFQHERFWLEGGDSKASATVTDGLDAGFWGAVERGDVEGLAGVLGSGVSVDVWGEVLPE
LSSWWLGRRARSVVEGWRYRVEWRRVGGGLLSGGGGLSGTWVVVVPVGVDVGLVDGCVGA
LVGCGVRVVVVGVDVGVLGDVEGLGSLVVGGLPEGVGVGDVSGVVSLLGLVEGWFEGLGG
VSLGVVGTLGLVRGLGGVGVVAPLWCVTRGAVGVGGGDVVVSPVQGLVWGLGRVVGLEHP
ERWGGVVDLPVSVDGRGWERFCSVLAGGGGEDQVAVRSSGVFVRRLVPAPVPVAVSGGGW
VGGLSGGSVVVTGGTGVLGGRVARWLAGCGVGRLVLVSRSGAAGVGVDGLVGELEGLGVV
VDVVACDVADREAMAGVLGGVSGEFPLRGVVHAAGASGMGALEGLGVEEFAGVVGAKVGG
AVVLDELVGGVPLVLFSSGAGVWGGGGQGAYSAANAFLDGLAEYRRGRGLPAVSIAWGPW
ADGGMVDAQAEQQLERRGLNSMSPELAIAAMEQAIESGDASLTVADVDWVKFYSAFASAR
PRPLLHDIPQVAEFLAETAAAENNTRQESGLAERLAGLSETERNRSVLELVRSHAAGVLG
HANLEAVGSERGFLDIGFDSLTAVEFRNRVSKSTGLSLPPTLLFDYPNAASLARHIVGQL
TSSDASSMLFSTLEMLESMLLDESVTDQMRLAVRQKIDPLLSPTPAITSDSSGEKTAEHF
DGLSPDEIFKMIDGSLGIDSSDAADAESGEA
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGGCTGACGAGGAAAAGCTCCAGTACTTCCTGCGCAAGGTCACCGTTGACCTTCGGGAG
AGCCGTCACCGGGTCAAGGAGTTGGAGGGCCGCTGGGCCGAGCCGCTGGCTGTGGTGGGC
ATGGCCTGCCGCTTCCCCGGCGGTGTGAACTCCCCGGAACAGCTGTGGGATTTTGTACTT
GATGGCCGGGACGGCATATCGGGATTCCCCACCGAGCGTGGCTGGGACCTCGATTCGCTC
TATCACCCGGATCCGGACCACCCGGGAACCTCTTACGCCTCCGAAGGCGGATTCCTCCAT
GACGCCGGGGAGTTCGACCCCGCCTTCTTCGGGATTTCGCCGCGTGAGGCGCTGGCGATG
GAGCCGCAGCAGCGGCTGCTGCTCCAGACCAGTTGGGAAGCGATCGAGAACGCCGGAATC
GACCCCCTCTCCCTCAAGGGCAGCAGGACCGGTGTCTTCGTCGGCGCCATCAACCAGGAA
TACGGCCCCCGCCTCTACGACGCCGCGCCGGACGACAACGTCGAGGGCTATCTGCTGACC
GGTACCGCCAACAGCGTGGTCTCCGGACGGGTGGCGTATGTCCTCGGCACCGAGGGCCCG
GCCCTCACGGTGGACACGGCGTGTTCGTCTTCGCTGGTGGCCCTGCACCTAGCCGGTCAG
GCACTGCGGCAGGACGAGTGCTCGATGGCGCTGGTCGGCGGTGTCACCGTGATGACCACA
CCGACGGGATTCGTGGAGTTCAGCCGTCAGCGGGGTCTGGCGGCGGATGGCCGGTGCAAG
TCGTTCGCGGCGGCTGCGGATGGTACGGGTTGGGCCGAGGGCGTCGGCGTGCTCGTGGTC
GAGCGGCTGTCGGACGCGCAGCGACTGGGTCACCCCGTGCTGGCGGTGATCCGTTCGAGT
GCGGTGAATCAGGATGGTGCGAGTAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGCAG
CGGGTGATCCGTCAGGCTCTGGCGGCTGCGGATCTGTCGTCCGCCGATGTGGATGTGGTG
GAGGCGCACGGTACGGGTACGGCGCTGGGCGATCCGATCGAGGCGCAGGCTCTCCTGGCC
ACGTACGGCCAGAACCGTCCCGAGGATCGGCCGCTGCGGCTGGGCTCGATCAAGTCGAAC
ATCGGACACACCCAGGCGGCTGCCGGTGTGGCGGGTGTGATCAAGATGGTGATGGCGCTG
CGGCACGGCGTCCTCCCGGCGACCCTCCATGTCGATGGGCCGACGCCGCATGTCGACTGG
ACCAGCGGCGCGGTCGAACTGCTCGCCGACACGACCGTTTGGCCCGAGGTGGACCGTCCG
TGGCGCGCGGCAGTCTCCTCCTTCGGCATCAGTGGTACCAACGCTCACACGATCATCGAG
CAGGCCCCTCCGGTGGAGGTCGGGGCTCCCGAGCCGGCCGTGAAGGGCAATGTCCTGGTG
CCGTGGGTGGTGTCGGGCCGTGGTGCGGACGCGCTGCGGGCGCAGGCCGCTCGGCTGCGG
GAGTGGGTGCTTGAGCACCCTGAGCACCGTTTGGTTGATGTGGGTCATTCGTTGGTAGTG
TCGCGGTCGGCTTTTGAGGATCGGGTGGTTGTTCTCGGTTCTGATCGGGATGCGTTGTTG
GATGGTCTGGCGGCGGCGGCTCAGGGTGAGCCGGGGCCGGGTGTGGTGGTGGGTTCGTCC
GCTGGTGCTGGTGGTGGGGTGGCGTTCCTGTTTACCGGGCAGGGCGCACAGCGCCTGGGT
ATGGGTCATGAACTCGCCGCACGTTTCCCGGTGTTCGCGTCTGCGCTGGACGAGGTCTGT
GTTCAGCTTGACGCGCATCTTGAGCGTCCGTTGCGTGAGGTGTTGTTCGCGGAGCCTGAC
ACTGAGGCTGCGGCGCTGCTGGACGAGACCGTGTTCACGCAGGCAGCGTTGTTTGCCGTT
GAGGTTGCGCTGTATCGGTTGGTGGAGTCGTGGTCGCTGACGCCGGACTACCTTCTGGGC
CACTCCGTCGGTGGTCTGGCCGCGGCGCATGTGGCGGGTGTGTTGTCGTTGGAGGACGCG
GCCGAGGTCGTGGTGGCTCGGGGTCGGTTGATGCAGGCCCTGCCCAAGGGCGGAGCCATG
GTCTCCCTCCAGGCGTCGGAGGACGAGGTCCTGGAATCGCTCAGCGGTCTGGTGTCGATT
GCCGCGGTGAATGGTCCGCAGGCGGTCGTCATCTCCGGTGACGAGGACGCCGTCACAGCG
GTGGCGGAGGAGTGGCGGGCTCGGGGCCGGAAGGTGAAGCGCCTCACGGTCAGCCACGCT
TTCCACTCGGCCCTGATGGAGCCAATGCTCGCCACCTTCGAGCAGGTCCTGTCTCGGGTC
ACGCTGAACGCCCCGCGGATCCCGGTCATCTCCGACTCCACCGGTCTGCCTCTCACACCG
GAGCAGGCCACCTCTCCCGCGTACTGGACCGGTCACGTCCGTAACCCGGTCCTGTTCCAC
CAGGCCGTCACCCACCTCACAGAGCAGGGTGTCAGTGCCTTCCTGGAACTGGGCCCCGAC
GGCGTACTCAGCGCCATGACCCGTACCAGCGTCGTGGGTCGGGACAACACCGTCGTCACC
CCCCTGCTCCGCGCCGACCGCGACGAACCGTACTCCGCGCTGACCGCGCTCGCCGAGCTG
TACGTCAACGGAACACACGTCGACTTCCGGGCCGTCCAGGAAGGCACCGGTGCGCGCCTG
GTCACCCTGCCCACATATGCCTTCCGCCACCAGTGGTTCTGGCTGCCGACCGGTACCCGC
CCTGCCACCGGCCTTGACGACGACCCGTTCTGGGGCATGGTCGAGCGTGGCGACGCCGCG
GAACTGGCGACCATCTTCGCCGAGCTGGGCGCGGAAGCCTCCGCCGAGGAGTGGGGCCAG
CTACTGCCCGCCCTGACCTCCTGGCGCCAGGCACAGCACGCCCGGTCCACCACGGACTCC
TGGCGCTATCGCATCACCTGGAAGCCCCGCACCGGCGCCCCCACCACCGCACTCTCCGGT
ACCTGGCTGGTCATCACCCCGACCGGGTACGACGAGACCGCCACGGAATGCGCCGCCGCC
CTCCGCCGACACGGAGCCGCGGTCATCCCCGTAACCCTGGACGCGTCCACGTCGGAGACC
GACCGCCACGCCTGGCACACCCGACTGGAGGCCGAGGCCGCCGCCATGGACGGCCGACTG
TCCGGTGTGGTGTCCCTGCTGGGGCTGGCCGAGGCGGCCTCCGACACCTCGCCCGCCGTC
CCGCACGGTGTCGCCGGGACGCTCGCCCTGGTGCAGGCGCTCGGCGACGCACGGATCCAG
GCCCCCCTGTGGTGCCTGACCCGAGGCGCCGTCTCCACCGGGCGCCCCGACCCGTTGCGT
TCCCCGCTCCAGGCGATGATCTGGGGATTCGGCCAGGTCGTCGGCCTGGAGCACCCCGCA
CGCTGGGGCGGCCTCGCCGACCTCCCCGAGACCGTTGACGACCACGGCTGGGATCAGCTG
TGCTCCGCCCTCGCCGATGGAGCCGAGGACCAGGTGGCCGTCCGCCCGGCCGGGCTCCTC
GTACGACGGCTCGTCCCCGCCGCGCCCGCGCCCGTCGTCGCGACCGGCGCGGATGCCCGC
GCAGCCGGAGGCACCGTACTGATCACCGGTGGCACCGGAGCCCTCGGCGGAAGCATTGCC
CGATGGGCCGCCGAACGCGGAGCACAGCGTCTTCTCCTCCTCAGCCGCAGTGGCGACCGC
GCACCCGGAGCCGAGGCCCTGCTCACGGAACTCGAAGCAGCGGGCTGCCCCGCCGAGATC
GTCGGCTGCGATATCGCCGACCGTGACGCGCTCGCCGCCGTCCTGGCCGCGATACCCGCC
GAGCACCCGCTCAGCGCCGTCATCCACACGGCAGGTGTCCTCGACGACGGGGTCATCGAC
TCCCTGACCCCGGACCGGATGGCGACCGTCCTCGCGGCCAAGCACACCGGAGCGAACAAC
CTCCACGAGCTGACGGCCGATCTGCCCCTTTCGGCCTTCGTCCTCTTCTCATCCGCCGCC
GCGACCTGGGGTGGCGTCGGCGGCCAGGGCTCCTACGCCGCCGCCAACGCCTATCTGGAC
GCACTCGCCGAACACCGCCGTGACCTGGGACTTCCGGCCAGCTCCATCGCCTGGGGCCCC
TGGGCCGACGGCGGCATGGCGGCAGCCGGAGACCTCGGCCGTGCGCTCGACCGCCGCGGC
CTCCAGCCCATGCGCCCCGAGTCGGCGACCGGCCTGCTGAGCCGGGTACTCGACCGCGGT
GACACCACCGTCACCATCGCCGATGTCGCCTGGGAACGCTTCTACCCGCTGCTCGCCACC
GCCCGCCCCAAGCCCTTGCTGCACGACATTCCGCAGATCGCCGCGCTGCTCGCCGAGACG
GGGGCCGACACCCTCCCGTCGGAACTCGGCTCCCGGCTCGCAGGTCTCCCCGACGAGGAC
CGGTCCCGGCTGGTCCTGGAAGCGGTACGCAGCCATGCCGCAGCCGTGCTCGGCCACGCC
AACACGGCCGGTGTGGAACCCAATCGTGCCTTCCGTGAGCTGGGTTTTGACTCGCTGACC
GCGATCGAGTTCTGCAACCGACTCATCCGGACCACCGGTCGGCCGCTTCCCCCGACGCTG
GTCTTCGACTACCCGACCCCGCTCGCCGTCGCCGACTTCATTCTCGGCGAACTCACGGGC
ACGGACCCGGCCGGCACTCCACACCGATCCGACACGGTGGCCACCGCAAGCCCGGATGAG
CCGCTGGCCATCGTCGGGATGGCCTGCCGTCTGCCCGGGGGAATCCGTACGCCCGAGCAG
TTGTGGCGGCTGGTCGCGGAGGGCGGTGACGCCGTCTCCGGTTTCCCCACTGACCGTGGC
TGGGACATTGAGTCGCTGTACCACCCGGATCCGGATCACCCGGGGACCTCGTACGCGAAC
GAGGGTGGCTTCCTTCACGAGGCCGGTGAGTTCGACGCGGGCTTCTTCGGGATTTCGCCC
CGTGAGGCGCTAGCGATGGACCCCCAGCAGCGGCTCCTCCTGGAGACGTCTTGGGAGGCG
ATCGAGAGCGCCGGAATCGACCCGCTCTCCCTGAAGGGCAGCTCGACCGGTGTTTTCACT
GGGATGAGCTACCACGACTACGCCTCGCCGATGACACCCGTCGCCGAAGGGCTCGAAGGC
TACCTCGGCACCGGTAATGCGGGGAGTGTGGTGTCGGGCCGGGTGGCGTATGTGTTGGGG
ACTGAGGGTCCGGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTCGCGCTGCAT
TGGGCGGCGCAGGCGTTGCGTCAGGGTGAGTGCTCGATGGCGTTGGCCGGTGGTGTGACG
GTGATGGCGACGCCGGGGATGTTTGTGGAGTTCAGTCGTCAGCGGGGGTTGGCGCCGGAT
GGTCGGTGTAAGGCGTTCGCGGCTGGCGCTGATGGTACGGGTTGGGCTGAGGGTGTTGGG
ATGGTGTTGGTGGAGCGGTTGTCGGACGCCCAGCGGCTCGGTCACTCGATTCTTGCGGTG
GTTCGTTCGAGTGCGGTGAATCAGGATGGTGCGAGTAATGGGTTGACGGCGCCGAATGGT
CCTTCGCAGCAGCGGGTGATCCGTCAGGCCCTGTCGACGGCCGGGCTGACGACCGCCGAT
GTGGACGCGGTCGAGGCGCATGGCACGGGGACGAATCTGGGTGACCCGATCGAGGCGCAG
GCCCTGCTGGCGACCTATGGTCAGGACCGTCCCGAGGGCCGGCCGCTGTTGCTCGGCTCG
TTGAAGTCGAACATCGGGCACACGCAGGCTGCGGCCGGTGTGGCGGGTGTGATCAAGATG
GTGATGGCGCTGCGGCATGGTGTGTTGCCGGCGACGTTGCATGTGGATGAGCCGTCGCCG
CATGTCGACTGGGCGAGCGGCGCGGTGGAACTGCTGACCGAGGCGACGGCCTGGCCCGAG
ACGGGTCGTCCGCGCCGGGCCGCGGTGTCGTCCTTCGGCATCAGCGGCACCAACGCGCAC
ACCATCCTCGAACAAGCACCGGCGGTCTCATCAGGCGAAACGGACGTTCCGTCGCGCGAG
ACAGGCGCGGAGCCCACGGCATGGGTGATCTCCGGACGGGGCAAGGAGGGCCTGATCCGG
CAGGCGGCCCGACTGCGTGACTGGGCGAACGAGCAGCCGGAGCACAGTGCGACCGATATC
GGCTTCTCGTTGTTGTCGTCGCGGTCGTTGCATCGGGATCGGTTGGTGGTGCTGGGTTCT
GATCGTCAGGTGTTGGTGGATGGGCTGGCGGCGTTTGTTGAGGGTGCGCCGTGGCCGGGT
GTGGTGGGTGGGTCGGGTGGTGGTGTGGTTGCTGATCGGCCGGTGTTCGTCTTCCCAGGT
CAGGGGTCGCAGTGGGTGGGGATGGGGCGGGAGTTGTACGCGTCGTCTCCCGTCTTTCGG
GCGCGGTTGGATGAGTGCGCGGCTGCGTTGGATCCGCTGGTGGACTGGTCCCTGATCGAT
GTTGTACGGGGTGAGTCCGGGGCTCCTGGTCTGGAACGGGTGGATGTGGTCCAGCCCGTC
CTCTGGGCCGTGATGGTGTCCCTGGCGGCTGTCTGGGAGTCGTGGGGTGTTACGCCGGCC
GCTGTGGTGGGTCATTCGCAGGGGGAGATTGCCGCCGCGTGTGTGGCGGGGGCGCTGTCG
GTGGAGGACGCTGCGCAGGTTGTGGCGTTGCGGAGCCGTGCCGTACGGGGGATGGCGGGT
GACGGTGCGATGGTGTCCGTCGCGCTCCCTGCCGCTGAGGCTGAGGCGTTGACCGGGGAC
GGTGTGTCGCTGGCGGCTGTCAACGGACCCTCGTCCGTGGTCCTCTCAGGGGACCGATCT
GCCCTCACCCCCGTGGTGGAGGGACTGACTGCTCAGGGTGTGCGGACGAAGTGGGTGCCG
GTGGACTACGCGTCCCACTCCGCCCATATGGACCGCATCCACGACGAGCTGCTGGAGATC
CTGTCCGGGATCGAGCCCAAGACCTCCCGTATCCCCCTCTACTCCGCCGTGTCGGCCGAG
GTCATCGACACATCGCGGATGGACGCCTCGTACTGGTTCGACAACATCCGGGGCACCGTC
CGCTTCCACGAGACCGTCCAGGCCCTCATCACCGACGGCCTCACCGCCTTCGTAGAGGTG
TCTCCGCACCCCGTCCTGGCGATGAGCGTCCAGGACACCCTCGACCAGGCCGAAGCCACC
GGTCTCTCCATCGGCACCCTCCGCCGCGACGAGAACGAACACGAAACCCTCCTCACCGCA
GCGGCTGAACTCTTCGTCGCCGGCCTCCCCATCGACTGGAACACGGCCGCCTACACGGGC
CGTTCCCCCCAGCGCGTCGACCTCCCCACCTACGCCTTCGCCCGCGAACGCTTCTGGCTG
CGCGCCGCATCCACGACCCCCACCGATGCCCGTGGCCTGGGCCTCGGCACCGTAGGACAC
CCACTGCTCGGCGCCGTCGTTGCCATGGCGGAGGGCGACACGACCGTCCTCACCGGCCAG
ATCTCGCTGCGTACGCACCCCTGGCTGGCCGACCACGCCGTCCTCGGCTCCGTACTCCTG
CCCGGCACCGCCTTCCTGGAACTCGCGATCCGCGCGGCCGACCACGTCGACTGCCCCCAG
GTCGAAGAACTGATCCTGCAAGCACCCCTGGTGCTCGCAGAGGACCGGGCGACCGATCTC
CAGATCCAGGTAGGACCGGCCGACGGAGACGGGATCCGGGCCGTCGACATCTACTCCCGT
CCCCACCCCGAGGACGAGCCCGCCGCCCAGGAACGATGGACCCACCACGCCTCCGGAACC
CTCGCACCCACCACTCGTACCGACACCGAGGACACCGGACTCTCCGTCTGGCCGCCGCAC
GATGCCACACCCCTACCGGTGACGGACATCTACCCACGCCTCAACCGGACCGGACTGGAG
TACGGCCCCCTGTTCCAGGGCCTGCGCGCCGCCTGGCGCAGCGGTGAGGAGATCTACGCC
GAGGTCGCCCTCCCCGACCACCAGGACGACACCGCCGCCCCCGGAGACTACGGAGTCCAC
CCGGCCCTCCTCGACGCGGCGCTCCACGCCATCGGCTTCCACCTCGGCGACCGCGCGACC
GACACCGAAGGCCAGGGCTGGCTGCCGTTCTCGTGGACCGGTGCCGCCCTGCACGCCGTC
GGCGCGTCGACACTCCGCGTACGACTCACCCCACAGGGACCGGACGCCGTCAGCCTGCTC
GCGGCGGACACCACTGGCGCGCCCGTCATCTCCATCGACTCGCTGACGCTGCGCCCGGTC
AGTGCCGAGCAGCTACGGACCCGGCCAGGGGCAGGACAGAACAGCCTGTTCGCGTTGGAC
TGGATCCCGGCAGGACCCGTGACCGGGACCGAAGCCGCCACCGGCCCATGGGCAATCCTC
GACATCGCGGGCATCGGCGGTGGCGAGACGGAGGCATTGGCGGACGCCCTCACCGTGCGG
GGCGTCCCGACCGAGGTCCACCCCGGGCTCGAAGCCGTACCCGCCGATGGCCAGAATGCG
CCGGTCGACGTCCTCCTCCCCGTACTGACCACCACGGCGGCCAACGAAGCCGACGCTCTG
GTCAGCCGGCTCCTCGGCGTGCTCCAGGAGTGGTTGCGCAGACCGGAACCGACCGCGTCC
CGGCTGATCGTGGTGACCCGTGGCGCGATCGCGACGGAGTCGGACGCGGACATCACCGAT
CTGGCCGCCGCCGCCGTCTGGGGATTGATCCGTACCGCCCAACTGGAGCACCCGGACCGC
TTCCTGCTGGTGGACGCGGATCAGCAGGCCCTCACCGACGGCTCAGTGGTGGACGCCGTA
CGCGGCGGTGAGCCGCAGACGGCGATCCGCCACGGTGAACTCCTCGTCCCGAGGCTCCAC
CGCGCCATGATGGAGGAGACCGGGGCCCCGACGGAGTGGGCCACCGAAGGCACCGTACTG
ATCACCGGCGGCACGGGTGTCCTCGGTGCCGCCCTCGCCCGCCACCTCGCCGACCGCGGC
GCCCGTCGACTGCTTCTCGTCAGCCGTCAGGGCGCGCGGGCGGCCGGGTCTGAGACCCTG
CTCGCCGATCTGCGTGCTACGGGGACACTGGCCGAGGCCGTCGCCTGCGATACGACCGAC
CGGGGCGCACTCGCCGAACTGCTGGCCGCCGTCCCGGACGCGTACCCGCTGACCGCCGTC
GTCCACGCGGCCGGAGTGCTGGACGACGCCATGCTGGAGTCGCTGACCCCGGCCCGTATC
GGCGCCGTACTCGCCCCGAAGGCCACCGCGGCCTGGAATCTGCACCAGCTCACCGCCGAG
CTGCCGCTCTCCGCGTTCGTCCTGTTCTCTTCGGCGACCGGTACGTTCGGCAACGCGGGC
CAGGCGGGTTACGGCGCGGCGAACGCGTTCCTCGACGCGCTCGCCCAGCACCGGCGAGCC
CATGGCCTGTCCGCAATCTCCCTGGGCTGGGGGCTGTGGGCTGAGGCCAGCGCGATGACC
GGCCATCTGGCCGAGCAGGACCGGGGCAGAATGCACCGCAAGGGAGCGGACCCGCTCACC
ACCGAACAGGGTCTCGCGCTGTTCGACACCGCGACCGCCCAGAGCAGGGCCCATCTGCTT
CCCGTGCCGCTGAACACCGGAGCGTTGCGCGACCGGGCCGTGCCGGTGACCTGCCCCATC
TCTTCCGCGACCTGGTACGGGTACCGGGTCGCCGCACCGCGGGCACCGGCGCGGGCGGCC
GGGACCGGCCTCGCCGCGCGACTCGCCTTGCTGCCGCTGGCCGAACGACAGCGGGAGACG
CTGGAACTCGTCCGCGCCAACGCGGCGGCGGTCCTGGGACACGCCGGCGCCGACAGCGTC
GGGGCCGAACGCGCCTTCCGGGAGCTGGGCTTCGACTCGCTCACCTCAGTGGAACTGCGC
AACCGGCTCAACGCGGCCACCGGACTGCGACTCCCCGCCACCCTGGTATTCGACTACCCG
ACACCGCTCGCCATCGCACTGCATCTGCTGGACTCGATGTTCCCGGACGGCGACGACCGG
ACGCCGTCAGCGCCGCAGCAGGCGGCGCTCGCGGCCATCGACGAACCGATCGCCGTGGTG
GGCATGGCCTGCCGTTACCCGGGCGGGGTCACCTCCCCGGAGCAGCTGTGGCAGCTCGTG
ACGAAGGGCGAGGACGCCATCTCCGGGCTCCCGCTCGACCGGGGCTGGGACATCGAGAAA
CTGTATGACCCGGACCCGGCCAACCCCGGCACCTCGTACACCCGCCATGGTGGCTTCCTG
CACGACGCCGGTGAGTTCGATGCGGGCTTCTTCGGGATTTCGCCGCGTGAGGCGCTGGCG
ATGGACCCCCAGCAGCGCCTTCTCCTGGAGACGTCTTGGGAGGCGGTCGAGAGCGCCGGA
ATCGACCCGCTCTCCTTGAAGGGCACGGACACGGGCGTCTTCGCGGGCGTCATGTACCAC
GACTACGCGACCCAGCTCGACGCGGTCTCCGAGGACGTGGGCGGATACCTCGGCACCGGC
AACGCGAGCAGCGTGGTCTCCGGCCGGATCGCCTACGCGATGGGGCTGGAGGGCCCGGCC
CTCACCGTCGACACGGCCTGCTCGTCGTCGCTGGTGGCGCTGCACCTGGCCGCCCACGCA
CTGCGTCAGGGTGAGTGCTCGATGGCGCTGGCCGGCGGTGTCACCGTGATGGCGACCCCG
GGGACGTACGTCGACCTCAGCCGTCAGCGGGGTCTGGCGGTGGACGGCCGGTGCAAGGCG
TTCGCCGCCGCTGCGGACGGGTTCGGACCGGCCGAGGGCGTCGGTGTGCTGGTGGTGGAG
CGGATCTCGGACGCGGAGCGCCTGGGCCACCCGATCCTTGCGGTGGTCCGTTCCAGTGCG
GTGAACCAGGACGGTGCCAGCAATGGCCTGACGGCGCCGAATGGTCCCTCGCAGCAGCGG
GTGATCCGTCAGGCACTCGCGTCGGCCGCTCTCTCCACCGCCGATGTGGATGTGGTGGAG
GCGCACGGTACGGGGACGGCGCTGGGTGACCCGATTGAGGCGCAGGCGTTGTTGGCGACC
TACGGTCAGGGTCGGCCGGAGGGTCGTCCGCTGCGGTTGGGTTCGTTGAAGTCGAACATT
GGTCATACGCAGGCCGCGGCGGGTGTGGCGGGTGTGATCAAGATGGTGATGGCGCTGCGG
CATGGTGTGTTGCCGGCGACGTTGCATGTGGATGAGCCGTCGCCGCATGTCGATTGGGCG
AGTGGCGCGGTGGAGTTGCTGACGGAGGCCATGCCGTGGCCTGAGGTGGGTCGTCCGCGC
CGGGCTGCGGTTTCGTCGTTCGGTATCAGCGGTACGAACGCGCACATCGTTGTTGAGCAG
GCGCCTGAGAGTCAGATCGAGGTTGCGGCTTCGCGGGAGGAGACTCCTGCCGGCTCGGTG
GCGTGGGTGCTGTCGGGCCGTGGCGAGGGTGCGCTGCGGGCGCAGGCGGCGCGGTTGCGG
GAATGGCTGTTGGAGCGGCCTGAAGACCGTCCGGTGGATGTGGGTTTCTCCCTCCTGTCG
TCGCGGTCGGTGTTTGAGGACCGGTTGGTGGTGCTGGGTTCCCAGCGTGAGGCGCTGCTT
GATGGGCTGGCGGCGGCGGCTGAGGGGGCGCCGTGGCCGGGGTTGGTTCAGTCGTCTGGG
GATGTGTCGCTGAGCCGGGCGGTGTTTGTGTTCCCGGGTCAGGGGTCGCAGTGGGTGGGG
ATGGGGCGTGAGCTGTATGCGTCGTCTCCCGTGTTCCGGGCGCGGTTGGATGAGTGTGCG
GCTGCGTTGGATCCGTTGGTGGAGTGGTCGCTGATTGATGTGGTGCGGGGTGAGTCCGGG
GCTCCTGGTCTGGAGCGGGTGGATGTGGTGCAGCCCGTTCTCTGGGCGGTGATGGTGTCG
CTGGCGGCTGTCTGGGAGTCGTGGGGTGTTGTCCCGGCCGCGGTGGTGGGCCACTCACAG
GGTGAGATTGCCGCTGCGTGTGTGGCGGGGGCGCTGTCGGTGGTGGACGCGGCGCGGGTT
GTGGCGTTGCGGAGCCGTGCCGTACGGGGGATGGCGGGTGACGGTGCGATGGTGTCGGTC
GCGCTCCCGGCCGCTGAGGCTGAGGCGCTGACCGGGGACGGTGTGTCCCTGGCGGCTGTC
AATGGACCCTCGTCCGTGGTCCTCTCGGGGGACCGGTCTGCCCTCACCCCCGTGGTGGAG
GGACTGACTGCTCAGGGTGTGCGGACGAAGTGGGTGCCGGTGGACTACGCGTCCCACTCG
GCCCATATGGAGCGCATCCACGACGAGCTGCTGGAGATCCTGTCCGGGATCGAGCCCAAG
ACCTCCCGTATCCCCCTCTACTCCACGGTGAGCGCTGCTCGTATCGACACGTCGCGGATG
GACGCCTCGTACTGGTTCGACAACATCCGGGGCACCGTCCGCTTCCATGAGACCGTTCAA
ACCCTGATCGCCGACGGCCTCACCGCCTTCGTGGAGGTGTCTCCGCACCCCGTCCTGGCG
ATGAGCGTGCAGGACACCCTCGACCAGGCCGAAGCGAACGGCCTGTCCATCGGCACCCTG
CGCCGCGACGAGAACGAACACGAGACCTTCCTCACCGCAGCGGCTGAACTCTTCGTCGCT
GGACTCCCCATCGACTGGAATACGGCCGCATTCACTGGAATGAGCGCCCGCCGAGTCGAT
CTGCCCGCCTATGCCTTCCAACGCCGTCACTACTGGCTGGACACCGCGTCGCAGACTGCC
GGTGACGCACAGGAACTGGGGTTGGGTGCCGTAGACCACCCACTCCTCGGCGCCAGCGTG
GGGGTCGCAGAGAGCGACCTAGTGGTACTCACTGGCCATCTCTCTCTGCGTACGCACCCT
TGGTTGGCCGACCATGCTGTCCTCGGCTCCGTACTCCTGCCCGGCACCGCCTTCCTGGAA
CTGGCCGTACGCGCTGGAGACCAGGTCGGACGCACTCGCCTGGAAGAGCTGGTCATCCAG
GCCCCGTTGCTGCTGGCAGATGACGCGCGAGACCTTCAGGTCGTGGTCGGAGCAGCGGAC
GAGACCGGACGTTCGACTGTGGACATCTACTCCCGTCCGCACGCTGACGGCGACCTCGAT
AGCGAGCGGGCATGGACGCACCACGCGGGCGGCATCCTCGCGGGCGGTCCTGTGGAGGAA
TTCGCGGACGCCGATCTCTCGATATGGCCGCCGCAGAACGCGACTCCGTTGGACATCGCT
GACTTCTACTCGCAGTTGGACCTGGCCGGCTACGAGTACGGTCCGGCGTTCCGGGGGTTG
CGGGCTGCCTGGCGCCGGGGCGACGAGGTGTTCGCCGAGGTGGAGCTGCCGGAGAGCGAG
CAGGACAGAGCCGCCGAGTTCGGTCTCCATCCCGCGCTGCTCGACGCCGCCCTCCAGGCG
ATCGGACTGACCGCCCTCGGAGACAGCGAACCGTCCGAGGAGGCCCAGCCTGGGAAGCTG
CCGTTCTCCTGGAATGGTGTGTCACTCCACGCGAGCGGAGCACCGATGCTGCGTGCTCGG
CTGCGCCCGCACGGGGACGAAGCGATAAGCCTGGTCGCGGCCGACGCTCATGGCGAGCCT
GTGCTCTCGGTCGACTCACTCGTTCTGCGGGCGTTGGACCCTCAGCAGCTCAACGGGGCT
CGAACCGCAGTACAGGAAGACCTGTTCGCGCTTGAGTGGGCGCCGTTGGGTGAACTCCCG
GAACAGGAGGCTGTTGAGCTCGGCGACTGGGCGTTGCTTGATGTGCCGGGTCTGAGTGGG
TCTGTTGATGGGTTGTTGGGTGGCTTGTTGGGGCGTGGGATCGAGCCGCGTGTGTGTGGC
TCGGTTGGTGAGTTGATGGTTGATGGCGTTGAGCCTGACGTGGTGCTTCTGCCGGTTGTT
GGTGGGGGTGGGGGTGGGGATGCGGTGGATGTGGTGTGTGGTGTGTTGGGTGTGGTGCGG
GAGTGGTTGGGGTTGGTTGGTGGTGTGTCGCGGTTGGTGGTGGTGACGTGGGGTGCTGTG
TCGGTGGGTTCGGGTGAGGGTGTGGGGGATGTGGGTGGTGCTGGGGTGTGGGGTTTGTTG
CGGAGTGCGCAGTCGGAGCATCCGGGTCGGTTTGTGTTGGTGGATGTGGAGGGTGTTGAG
GGTGTGGGGTGGGGTGGGTTGGTTGATGGTGTGGTGTGTGGTGAGGGTCAGGTTGTGGTG
CGGGGTGGTGGGTTGTTGGTGCCGCGGTTGGTGCGGGCTGGTGGTGGTGGGTTGGTGATT
CCGGAGACATTCACGGGTGGTGTTTCGGGTGTTGGTTCGGCTGGTGTAGGGGTTGAGAGT
TCGGGTGAGGTCCTGGGTTCGAGTGTGGGTGGGGTGGGGTCTGGTTGGTGTGTGGGTGTG
GGGGTGGGTTCTGGTGTGGGGACTCTGGAGGGGCTGGGTGTGGTGAGTGCGGGTGCGGGT
GCGGGTGTGGGTGTGGGTGTTGGTTCGGGTGTGGGTGGTGGGTTGGGTGTGGGTGAGGTG
AGGGTTGCGGTGCGTGCTGCGGGGGTGAATTTTCGTGATGTGTTGATTGGTTTGGGTGTG
TATCCGGGGGAGGCGTTGTTGGGGAGTGAGGGTGCGGGTGTGGTGGTGGGTGTGGGTGAG
GGTGTGGTGAATGTGGGGGTGGGTGATCGGGTGATGGGTTTGTTTTTGGGTGGGTTTGGT
CCGGAGGTGGTGGTGGATGCGCGGATGGTGGTGCGGTTGCCGGTGGGGTGGTCGTTTGTG
GAGGGTGCGACGGTGCCGGTGGTGTTTTTGACGGCGTGGTACGGGTTGGTGGATTTGGCG
GGGGTGCGTGCGGGGGAGCGGTTGTTGGTGCATGCGGCGGCTGGTGGTGTTGGGATGGCG
GCGGTGCAGTTGGCGCGGCATTGGGGTGTGGAGGTGTTCGGGACGGCGAGTGAGGGCAAG
TGGGAGGTTCTTCGGGGTCTGGGGTTGGATGACGCGCATATCGCTTCTTCTCGGGACCTT
GGCTTTGTGGAGAAATTCGGGCGTGGTTCGTCTGGTAATGGTGGTGGTGTGGATGTGGTG
TTGAATTCGTTGGTGGGTGAGTTTGTGGATGGGTCGTTGGGGTTGTTGGGTGAGGGGGGT
CGGTTTGTTGAGATGGGGAAGTTGGATGTGCGGGATGCGGGTGTGGTGGGGGAGTTGTGG
TCGGGTGTTTGGTATCGGAATTTTGATTTGGTGGAGGCGGGGTTGGATCGTATTCAGGAG
ATGTTGTGTGAGTTGGTGGGGTTGTTTGATGTGGGTGTGTTGGAGGCGTTGCCGGTGCGG
TGTTGGGATGTGCGGGAGGTGGTGGATGCGTTGAGGTTTGTGCAGCAGGCGCGTCATGTG
GGGAAGGTGGTGTTGCGGGTTCCTGGTGGTTGGGGTTCGGGGACGGTGGTGGTGTCGGGT
GGTACGGGTGTGTTGGGGCGTGCGGTGGTGCGGTATTTGGTGGGGTGTGGTGTGGGGCGG
TTGTTGTTGTTGAGTCGTTCGGGTGCTGCGGGTGAGGGCGTTGCCGGGCTGGTGGGGGAG
TTGGAGGGGTTGGGTGTGGTGGTGGATGTGGTGGCGTGTGATGTGGGTGATCGTGAGGCG
TTGGCGGGGGTTTTGGGTGGGGTGTCGGGGGAGTTTCCGGTGACGGGTGTGGTGCATTTG
GCGGGTGTGTTGGATGACGGGATGGTGGAGTCGTTGTCGGAGGGTCAGGTGCGGCGGGTG
TTTGCGGGGAAGGTGGATGGGTTGGTGAATTTGGATGTGTTGACGCGGGGGATGCCGGTT
GAGGGGTTTGTGGTGTTTTCGTCGGCGGCTGGTGTGTTTGGTAATGCGGGGCAGGGGAAT
TATGCGGCGGCTAATGCGTGTGTGGATGCGGTGGTGGCGCGGCGGCGGGTTGAGGGTTTG
CCGGGGGTGTCGTTGGCGTGGGGGTTGTGGTCCGAGGCGAGTGGGATGACCGGGCACCTT
GACGCGGGGGATCACGACCGGATGAACCGGGCCGGACTCGCTGGGTTCTCCACCGATCAC
GGGCTGGCGCTCCTTGAATCCGCCCTTGCACTGCCGCACGCCCAACTGTTGCCCATTCGG
CTCGATCGAGCCCGGTTGCAGGCGCGGGCGGATGTGGGGGATGTGCATCCGTTGTTGCGG
GGGTTGGTGCGTTCTCGGTCGCGTCGGGCGGCGAGTGCCGTGGGTATTGGTGTGGGTGGT
TTGGGTGGTCGGTTGGTTGGTTTGGTGGAGGGTGAGCGGCGTCGGGTGGTTTTGGATTTG
GTGCGGTCTCATGCGGCGACGGTGTTGGGGCATGGGGATGTGGCGGGTGTGGGTGCGGGG
CGGGCTTTTCGTGAGTTGGGGTTTGATTCGTTGACGGCGGTTGAGTTGCGGAATCGGTTG
AATACGGCGACGGGGGTGCGGTTGCCGGCGACGTTGGTGTTTGACTATCCGACCCCGACC
GAGCTGGCGGACTATTTGTTGGTTCAGATGGTTGGTGAGTCGGGTGCGGCCGACTCCGTC
CAGGTGCCGATATCGGTTTCGTCGGAGGAGCCGTTGGCTGTGGTGGGTATGGCGTGCCGG
TTCCCTGGTGGGGTGGGTTCGCCGAATGAGTTGTGGGACTTTGTGTTGGCTGGTGGGGAT
GGTATTTCGGGTTTGCCGGTGGATCGGGGTTGGGATGTGGCGGGGTTGTTCGATCCGGAT
CCGGAGCGTGAGGGGACTTCGTATACGCGTGAGGGTGGTTTCCTTCATGATGCGGCGGAG
TTCGATCCCGGATTCTTCGGGATTTCGCCGCGTGAGGCGTTGGCGATGGACCCCCAGCAG
CGGCTTCTCCTGGAAACATCGTGGGAGGCGGTTGAGAACGCGGGTATCGATCCGTTGAGT
TTGAAGGGGACCAGTACCGGAGTCTTCGCAGGAGTCACCTACCACGACCATGCCCTGCGT
TTGCAGTCGATCAGCGGAACTCCGGATGGGCTGCTGGGAACGGGTAGCTCCGCGAGCGTC
GTATCCGGTCGCGTGGCCTACGTCCTCGGTCTTGAGGGTCCGGCGCTGACGGTGGACACG
GCGTGTTCGTCGTCGCTGGTCGCGTTGCATCTGGCGGGACAGGCCCTGCGGCAGGGCGAG
TGCTCCATGGCACTCGCCGGCGGTGTGACCGTGATGGCGACCCCGGGGACGTTTGTCGAC
TTCAGTCGTCAGCGGGGTCTTGCTGCGGACGGTCGGTGCAAGGCGTTCGATGTCTCTGCC
GATGGGTTCGGGCCGGCCGAGGGCGTCGGCATGTTGGTCCTGGAGCGGCTGTCGGACGCG
CAGCGCCTGGGCCACCCCGTCCTCGCCGTTATCCGGGGCAGTGCGGTGAATCAGGACGGT
GCGAGTAATGGCCTGACGGCTCCGAATGGTCCGTCGCAGCAGCGGGTGATCCGCCAGGCC
CTGGCCTCGGCCGGTCTCTCGACCATGGACATCGACGCGGTGGAGGCGCACGGCACCGGC
ACGGCGTTGGGTGACCCGATCGAGGCTCAGGCGCTGCTTGCCACCTACGGTCAGGATCGT
CCCGAGGATCGGCCGCTGAGGCTGGGCTCGATCAAGTCGAACATCGGACACACCCAGGCG
GCTGCCGGTGTCGCCGGTGTCATCAAGATGGTGCTCGCCATGCAGCACGGCGTCCTCCCG
CCCACACTGCATGTCAACGAACCGACCCCGCATGTCGATTGGGCGAGCGGCGCGGTTGAG
CTGCTGACCGAGGCCACCGCCTGGCCCGAGACGGGCAAACCACGTCGGGCTGCGGTGTCG
TCGTTCGGTATCAGCGGCACCAACGCTCACACGATCATCGAACAGGCCCCTCAGGTGGAG
GTCGGGGCTCTCGAGCCGGCCGTGAAGGGCGATGTCCTGGTGCCGTGGGTGGTGTCGGGC
CGTGGCGCCGACGCCCTGCGGGGCCAGGCCGCCCGGCTGCGGGAGTGGGCGTTGAAGCAC
CCCGAGGAGCGCTTGATCGATGTTGGTCATTCGTTGGTGATGTCGCGGTCGGCTTTTGAG
GATCGGGCGGTTGTTCTCGGTTCGGATCGCGAGGCGTTGTTGGATGGTCTGGCGGCGGCT
GCTCAGGGTGAGCCCTGGCCCGGTGTCGTGCAGGGTTCGTCTGTCGGGTCCGGTGGTGGG
GTGGCGTTCCTGTTTACCGGGCAGGGCGCACAGCGCGTCGGCATGGGCCGTGAACTCTCC
GCACGTTTCCCGGTGTTCGCGTCCGCGCTGGACGAGGTCTGCGTTCAGCTCGACGCCCAT
CTGGAACGTCCGCTACGTGAAGTGCTCTTCGCCGAACCTGACACCGAGGCTGCGGCGCTG
CTGGACGAGACGGCTTTCACCCAGGCAGCCCTGTTTGCCATTGAGGTCGCGCTCTATCGG
CTGGTCGAGTCGTGGTCCCTGACGCCGGACTATCTCCTGGGCCACTCCATCGGTGGTCTG
GCCGCCGCGCATGTGTCGGGTGTGCTGTCGTTGGAGGACGCGGCCGAGGTCGTCGCGGCT
CGGGGTCGGTTGATGCAGGCCCTGCCCAAGGGCGGAGCCATGGTCTCCCTCCAGGCGTCG
GAAGACGAGGTCGTCGAGTCGCTGGACGGCCGGGTGTCGATCGCCGCGGTGAATGGTCCG
CAGGCGGTCGTCATCTCCGGAGACGAAGACGCCGTCACAGCGGTGGCGGACGAATGGCGG
GCCCGGGGCCGGAAGGTGAAGCGCCTCACGGTCAGCCACGCCTTCCACTCGGTGTTGATG
GAGCCGATGCTCGCCGAGTTTGAGCAGGTCCTGTCTCGGGTGACGCTGAACGCCCCGCGG
ATCCCGGTCATCTCCGACTCCACTGGCCTGCCTCTCACGGTGGAGCAGGCCACCTCTCCC
GCGTACTGGACCGGTCACGTCCGTAACCCGGTCCTGTTCCACCAGGCCGTCACCCACCTC
ACCGGCCAAGGCGTGAACAGCTTCCTGGAGCTGGGCCCCGACGGCGTACTGAGCGCCATG
ACCCGCACGAGCCTGGCCGACGACAGTGACATTACGGTCGTGCCGCTGCTGCGGCGGGAC
CGGGAAGAGTCTGAGGCGGCGCTGACTGCGCTGGCCGAGCTGTATGTCAACGGCGCGGTG
GTGGAGTGGTCTGCGGTGTTCGGTGGCGGGGAGGCAGTGCGCCGGGTCGATCTGCCGACC
TACGCCTTCCAGCATGAGCGCTTCTGGCTTGAGGGTGGTGACAGCAAGGCTTCGGCGACT
GTGACTGATGGCTTGGATGCTGGTTTTTGGGGTGCGGTGGAGCGGGGGGATGTGGAGGGT
TTGGCTGGGGTGTTGGGGTCTGGGGTGTCGGTGGATGTGTGGGGTGAGGTGTTGCCGGAG
TTGTCGTCGTGGTGGTTGGGGCGGCGGGCTCGGTCGGTGGTGGAGGGGTGGCGGTATCGG
GTGGAGTGGCGTCGGGTGGGTGGTGGGTTGTTGTCGGGTGGTGGTGGGTTGTCGGGGACG
TGGGTGGTGGTGGTTCCGGTGGGGGTGGATGTGGGGTTGGTGGATGGGTGTGTGGGTGCG
TTGGTGGGGTGTGGTGTGCGGGTGGTTGTGGTGGGTGTGGATGTGGGTGTGTTGGGTGAT
GTGGAGGGGTTGGGGTCGTTGGTGGTGGGTGGTTTGCCGGAGGGTGTGGGTGTGGGTGAT
GTGTCGGGTGTGGTGTCGTTGTTGGGGTTGGTGGAGGGGTGGTTTGAGGGGTTGGGTGGT
GTGTCGTTGGGTGTGGTGGGGACGTTGGGGTTGGTGCGGGGGCTGGGTGGTGTGGGTGTG
GTGGCTCCGTTGTGGTGTGTGACGCGGGGTGCTGTGGGTGTGGGTGGTGGGGATGTGGTG
GTGTCTCCGGTGCAGGGTTTGGTGTGGGGGTTGGGTCGGGTGGTGGGTTTGGAGCATCCG
GAACGGTGGGGTGGTGTGGTTGATCTGCCGGTGTCGGTGGATGGTCGGGGTTGGGAGCGT
TTCTGTTCCGTCCTGGCGGGTGGTGGTGGTGAGGATCAGGTGGCGGTGCGGTCGTCGGGC
GTGTTCGTACGACGCCTCGTCCCGGCTCCCGTCCCGGTTGCGGTCTCGGGTGGGGGTTGG
GTTGGTGGGTTGTCGGGTGGGTCGGTGGTGGTGACGGGTGGTACGGGTGTGTTGGGTGGT
CGTGTGGCGCGTTGGTTGGCCGGGTGTGGTGTGGGTCGTTTGGTGTTGGTGAGTCGTTCG
GGTGCTGCGGGTGTGGGTGTTGATGGGTTGGTTGGGGAGTTGGAGGGGTTGGGTGTGGTG
GTGGATGTGGTGGCGTGTGATGTTGCGGATCGTGAGGCGATGGCGGGGGTTTTGGGTGGG
GTGTCGGGGGAGTTTCCGTTGCGGGGGGTGGTGCATGCGGCGGGTGCGAGTGGGATGGGT
GCGTTGGAGGGGTTGGGTGTGGAGGAGTTTGCGGGTGTGGTGGGGGCGAAGGTGGGTGGG
GCTGTGGTTTTGGATGAGTTGGTGGGTGGGGTGCCGTTGGTGTTGTTTTCGTCGGGTGCT
GGTGTGTGGGGTGGTGGTGGTCAGGGTGCGTATTCGGCTGCGAATGCGTTTTTGGATGGG
TTGGCGGAGTATCGGCGGGGTCGTGGGTTGCCGGCTGTGTCGATCGCGTGGGGCCCGTGG
GCCGACGGCGGAATGGTCGATGCCCAGGCGGAGCAACAATTGGAGCGCCGTGGGCTGAAT
TCGATGTCGCCTGAACTCGCCATCGCGGCGATGGAGCAGGCCATCGAGAGCGGGGATGCC
AGCCTTACGGTTGCCGACGTCGACTGGGTGAAGTTCTACTCGGCATTCGCGTCGGCTCGC
CCTCGCCCGCTGCTGCACGACATTCCGCAGGTCGCGGAATTCCTCGCGGAGACAGCAGCC
GCCGAAAACAACACCCGTCAGGAGTCGGGACTCGCCGAACGGCTGGCGGGCCTCTCCGAG
ACGGAGCGGAACCGGTCCGTTCTTGAGCTGGTTCGATCCCATGCGGCCGGTGTGCTCGGC
CATGCCAACCTGGAAGCGGTCGGCAGCGAACGTGGCTTCCTCGACATCGGGTTTGACAGC
CTGACCGCCGTTGAGTTCAGGAACAGGGTCAGCAAGAGCACCGGCCTTTCGTTGCCGCCC
ACCCTTCTCTTCGACTATCCGAACGCGGCAAGCCTGGCGCGTCATATCGTCGGCCAACTG
ACGTCCTCCGACGCAAGTTCGATGCTCTTTTCCACGCTGGAGATGTTGGAATCCATGCTC
CTCGACGAATCGGTAACGGATCAGATGCGCCTTGCGGTCAGACAGAAGATCGATCCGTTG
CTCTCACCGACCCCTGCCATCACCAGCGATTCATCGGGCGAGAAGACGGCCGAACACTTC
GACGGGCTGAGTCCGGACGAGATTTTCAAAATGATCGACGGATCTCTCGGCATCGACTCG
TCGGACGCCGCGGACGCAGAGAGCGGGGAAGCCTGA
[3] KS34..412
[3] AT569..886
[3] malonyl-CoA759..763
[3] KR1204..1384
[3] ACP1485..1555
[4] KS1580..1956
[4] AT2115..2429
[4] methylmalonyl-CoA2303..2307
[4] DH2480..2648
[4] KR2977..3156
[4] ACP3260..3330
[5] KS3354..3731
[5] AT3888..4202
[5] methylmalonyl-CoA4076..4080
[5] DH4253..4420
[5] ER4787..5105
[5] KR5114..5293
[5] ACP5397..5467
[6] KS5490..5865
[6] AT6023..6339
[6] malonyl-CoA6213..6217
[6] KR6667..6843
[6] ACP6947..7017
[3] KS100..1236
[3] AT1705..2658
[3] malonyl-CoA2275..2289
[3] KR3610..4152
[3] ACP4453..4665
[4] KS4738..5868
[4] AT6343..7287
[4] methylmalonyl-CoA6907..6921
[4] DH7438..7944
[4] KR8929..9468
[4] ACP9778..9990
[5] KS10060..11193
[5] AT11662..12606
[5] methylmalonyl-CoA12226..12240
[5] DH12757..13260
[5] ER14359..15315
[5] KR15340..15879
[5] ACP16189..16401
[6] KS16468..17595
[6] AT18067..19017
[6] malonyl-CoA18637..18651
[6] KR19999..20529
[6] ACP20839..21051

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-694]  G3DSA:3.40.366.10 [759-876]  G3DSA:3.40.366.10 [2113-2238]  G3DSA:3.40.366.10 [2303-2420]  G3DSA:3.40.366.10 [3886-4011]  G3DSA:3.40.366.10 [4076-4193]  G3DSA:3.40.366.10 [6018-6148]  G3DSA:3.40.366.10 [6213-6330]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4925-4946]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [3288-3303]  PS00012 [5425-5440]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1485-1559]  7.99999999999993e-85 G3DSA:1.10.1200.10 [3257-3331]  7.99999999999993e-85 G3DSA:1.10.1200.10 [5395-5467]  7.99999999999993e-85 G3DSA:1.10.1200.10 [6946-7020]  7.99999999999993e-85 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1485-1555]  PS50075 [3260-3330]  PS50075 [5397-5467]  PS50075 [6947-7017]  PS50075
PS50075   ACP_DOMAIN
 [1488-1554]  7.7e-10 PF00550 [3263-3329]  2.6e-11 PF00550 [5400-5466]  7.79999999999999e-12 PF00550 [6950-7016]  2.3e-10 PF00550
PF00550   PP-binding
 [1478-1596]  9.80000272130218e-24 SSF47336 [3253-3371]  2.10000267834031e-27 SSF47336 [5390-5506]  8.80000265836278e-29 SSF47336 [6938-7024]  6.30000946287306e-21 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [4815-4943]  7.00000734129907e-27 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4936-5045]  6.1e-12 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4818-4873]  2.4e-05 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1204-1384]  7.29999999999998e-64 PF08659 [2977-3155]  2.89999999999999e-60 PF08659 [5114-5292]  5.59999999999999e-54 PF08659 [6667-6843]  5.59999999999999e-52 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-286]  5.99999999999995e-96 PF00109 [1580-1830]  1.39999999999997e-96 PF00109 [3354-3605]  6.7999999999999e-97 PF00109 [5490-5740]  5.69999999999998e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-412]  4.9e-48 PF02801 [1838-1956]  1.9e-47 PF02801 [3613-3731]  7.4e-47 PF02801 [5748-5865]  6.80000000000006e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-886]  2.4e-62 PF00698 [2115-2429]  5.50000000000008e-106 PF00698 [3888-4202]  9.69999999999989e-106 PF00698 [6023-6339]  2.59999999999995e-65 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  9.59999999999999e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-881]  1.79999754022378e-67 SSF52151 [2113-2412]  1.39999277195148e-72 SSF52151 [3886-4185]  1.3000049540733e-71 SSF52151 [6020-6324]  1.19999063421924e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-758]  1.20000117458134e-17 SSF55048 [2240-2302]  2.70000183580794e-16 SSF55048 [4013-4075]  2.70000183580794e-16 SSF55048 [6150-6212]  6.79998707392904e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-298]  G3DSA:3.40.47.10 [300-464]  G3DSA:3.40.47.10 [1580-1841]  G3DSA:3.40.47.10 [1844-2007]  G3DSA:3.40.47.10 [3354-3616]  G3DSA:3.40.47.10 [3619-3784]  G3DSA:3.40.47.10 [5493-5752]  G3DSA:3.40.47.10 [5753-5918]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-410]  3.89999861795218e-103 SSF53901 [1572-1954]  1.79999754022378e-101 SSF53901 [3354-3783]  2.2999842048857e-100 SSF53901 [5482-5864]  3.699978135861e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1201-1390]  G3DSA:3.40.50.720 [2976-3162]  G3DSA:3.40.50.720 [4888-5069]  1e-42 G3DSA:3.40.50.720 [5114-5302]  1.39999999999997e-127 G3DSA:3.40.50.720 [6664-6856]  1.39999999999997e-127 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [199-215]  PS00606 [1743-1759]  PS00606 [3518-3534]  PS00606 [5653-5669]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-867]  3.699978135861e-115 SM00827 [2117-2411]  2.1000026783403e-127 SM00827 [3890-4184]  1.19999063421924e-128 SM00827 [6024-6321]  4.10001399699315e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1486-1558]  1.10000150671642e-31 SM00823 [3261-3333]  1.39999892049878e-32 SM00823 [5398-5470]  2.99998750445706e-35 SM00823 [6948-7020]  1.99999636034521e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2480-2648]  3.60002015031011e-81 SM00826 [4253-4420]  1.59998835313644e-77 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-464]  SM00825 [1582-2008]  SM00825 [3357-3783]  SM00825 [5492-5918]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1204-1384]  6.00001679190159e-60 SM00822 [2977-3156]  1.10000150671643e-58 SM00822 [5114-5293]  3.29999077503323e-43 SM00822 [6667-6843]  1.99999636034521e-36 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4787-5105]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit