close all open/close all

CDS information : Halsto_00030


close this sectionLocation

Organism
StrainHC34
Entry nameHalstoctacosanolide
Contig
Start / Stop / Direction35,002 / 50,664 / + [in whole cluster]
35,002 / 50,664 / + [in contig]
Location35002..50664 [in whole cluster]
35002..50664 [in contig]
TypeCDS
Length15,663 bp (5,220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)hlsC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16568718] The complete biosynthetic gene cluster of the 28-membered polyketide macrolactones, halstoctacosanolides, from Streptomyces halstedii HC34. (J Antibiot (Tokyo). , 2006)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
8 malonyl-CoA
9 malonyl-CoA
KS34..410
AT566..880
KR1207..1386
ACP1488..1558
KS1593..1969
AT2126..2439
DH2490..2665
KR2999..3178
ACP3279..3349
KS3372..3748
AT3907..4225
DH4271..4438
KR4778..4957
ACP5061..5131

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MSNEQKMFEYLKRTMAELENSRSRVAELEGRSAEPLAIVGMACRYPGGVTSPEQLWKLVA
EGRDGVTEFPTDRGWDIENLYNPDPNHQGTSYACEGGFLHDAGEFDPAFFGISPREALAM
DPQQRLLLETSWEAVENAGIDPLILRGSRAGVFVGTSSQDYAVTANQAADATDGYLLTGT
AGSVISGRVAYVLGAEGPAVSVDTACSSSLVALHLAMQALRNDECSMALVGGVAVMATPT
GFVEFSRQRGLAADGRCKSFAAAADGTGWAEGVGVLVVERLSVAQRLGHRVLAVIRSSAV
NQDGASSGLTAPNGPSQQRVIRQALASAGLSTADVDVVEAHGTGTSLGDPIEAQALLATY
GQGRPKGRPLLLGSLKSNIGHAQAAAGVAGVIKMVMALRHGVLPATLHVDEPTPHVDWAS
GAVELLTESRPWPETGRPRRAAVSSFGISGTNAHAILEQAPEDGTAQVATTDGDSLVPWV
LSGRGAAGVRAQAARLREWLLERPGAHPADIGSSLLTSRSLFEDRLVVLGSHQDVLLDAL
AAVVEGAPWPGVVGGSGGGVVADRVVFVFPGQGSQWVGMGRELYTSSPVFRARLDECAAA
LDPLVEWSLIDVVRGESGAPGLERVDVVQPVLWAVMVSLAAVWESWGVVPAAVVGHSQGE
IAAACVAGALSVEDAARVVALRSRAVRAMAGDGAMVSVALPAAEAEALTGDGVSLAAVNG
PSSVVLSGDRSALTPVVEGLTAQGVRTKWVPVDYASHSAHMERIHDELLEILSGIEPKTS
RIPLYSTVSAARIDTSRMDASYWFDNIRGTVRFHETVQALIADGLTAFVEVSPHPVLAMS
VQDTLDQAEATGLSIGTLRRDENEHETLLTAAAQLFVAGLPIDWHTAAFTGRETRRVDLP
TYAFQRERFWLEAGTAIAEVAAVDGAEARFWDVVERGDAEELAAALAAAGVDASVEALEP
VLPVLSSWRQVQRARTAAQSWRYQVTWKPRTGAATDGSLSGTWLVLAPQPGSFDGLTAEC
VSALEERGATAVVLRPDGPAVGDRASWRALLDGALADTPDQPVSGAVALLGLAEDPLTEF
PVVSAGLAGVLALVQALGDVGIEAPMWCLTQGAVSVGRTDPVRHPTQALVWGLGRVIPLE
APQRWGGLIDLPETVDQSCWDRIGSALAGDGGEDQIAIRTSGTYVRRLVTAPASDRATSG
GWTPGDGTVLITGGTGALGRHVARWTASRGARRLLLLSRSGHRAPEAEALVAELSEAGCH
ADVVACNIADRDALATVLAAIPAEHPLTTVIHTAAALDDGVIDSLSPSRMAAALRAKKAG
AWNLHELTSELDLAHFVLFSSFGAVVGSPGQGNYAPANAYLDALAQYRRSHGLAATAIAW
AALAGDGMARESDIFDRFARHGVPPMSPEQALEALGVALAGDETCVSIADISWKQFWTAN
NAERANLFFNEIPEVQALLAEHAATTDSGSGLAARLVGLAGPERHRTLLDLVRGHVAAVL
GHSGPENVAAGRAFRELGFDSLTAVELRNRLNAATGLQLSATLVFDYPTPTIITEHLLGQ
LLGEGEGEGEGDGEDENGAVARPRPTAAHVSNEPLAVVGMACRFPGGVATPEQLWRLVAE
GVDGISGFPVDRGWDERALFDPDPDNQGTTYACEGGFLHDAAKFDPEFFGISPREALAMD
PQQRLLLETSWEAVENAGIDPLTLRGSATGVFAGVTYHDYSARLRSIPEGLEGLLSTGSS
GSVVSGRVAYVLGLEGPALTVDTACSSSLVALHLAGQALRQGECSIALAGGVTVMSTPGT
FIGFSRQRGLAADGRCKAFGAAADGFGPGEGVGMLVLERLSDAQRLGHPVLAVIRGSAVN
QDGASNGLTAPNGPSQQRVIRQALASAGLSTADVDVVEAHGTGTSLGDPIEAQALLATYG
QGRPEDRPLRLGSIKSNIGHTQAAAGVAGVIKMVMALRNGVLPPTLHVDEPTPHVDWASG
AVELLTEAASWPEVDRPWRAAVSSFGISGTNAHTIIEQAPQVEVGALEPAVKGDVLVPWV
VSGRGADALRAQAARLREWVLEHPEHSLVDVGHSLVVSRSAFEDRAVVLGSDREALLDGL
AAAAQGGPWPGVVQGSSVGSGGGVAFLFTGQGAQRVGMGRELSVRFPVFASALDEVCVQL
DAHLERPLREVLFVEPDTEAAALLDETAFTQAALFAIEVALYRLVESWSLTPDYLLGHSI
GGLAAAHVAGVLSLEDAAEVVVARGRLMQALPKGGAMVSLQASEDEVVESLDGRVSIAAV
NGPQAVVISGDEDAVTAVADEWRARGRKVKRLTVSHAFHSALMEPMLATFEQVLSRVTLN
PPRIPVISDSTGLPLTPEQATSPAYWTAHVRNPVLFHQAITHLTGQGVNSFLELGPDGVL
SAMVQHSAPDAAQATPLLRSGVDEPEAALTAVAGLFVTGRTLDWNAVLADPGARRVPLPT
YSFQYGHYWLKTDTTPGADAALHGLASLQHPLLSACVTVAEGDLVLLTGQLSLRNHPWLA
DHAVLGSVLLPGTAFLELAVRAGDQVGCARVEELVIQAPLILADDDTAAPQDVQILVGAP
QPDSARSVDIYSRPHTDGDAGPDHDAWTHHASGVLTTGSRGESSVAPDTSLTTWPPQQAV
PIPLDDFYPRLDRLGFGYGPLFQGLHAAWRSGDEVYAEIRLPEQDDDTAGGTDFGIHPAL
LDAALHAISLTVPEQADDSDTPQGGLPFSWTGIELHAGGAAALRVRLRRNDDDSVSLLAA
DAVGAPVVSVESLVLRPVTAEHVRADRSAHRDALFNLDWVLGEAAPDPRESTWGILTVPG
LTTGTEDVEAGLTLRGVTVSELAGIPVVPSETGPLPQDSRPAPDTVVVPLSFTDNGTAAT
AVTTTLAVVQQWLASPEWSASRLLVLTRGAVAVEPGEDVTDLAAAAVWGLLRTAQSENPD
RFLLVDSDERGIDGGSLLEAVAADEPQIALRDGRIRLPRLHRAQLDEDCERHDWSATPGT
VLVTGGTGSLGQAVAAHLADQGVSRLLLLSRRGPDAPGAGELVERLNAAGAAVEIVACDV
ADREALAGVLAGIPPEHPLCAVVHTAGVVSDATIPSLTPGQVAAVFAAKGDAAWHLHELT
AETPLSAFVLFSSASGTIGNAGQGNYAAANAFLDALARHRSARGLPAVSLGWGLWAEPSG
MTGGLSGADRARMARGGVTALTTRQGLELLDTALGAGTPWMLPIKLNLRALRGSVAVPHL
LRDLAPASVRRHATAGSENAGTLAARLAGLAETEQRQLLLETVRGQVATVLGHARPEHIQ
PERAFRELGFDSLTSVELRNRLNTATGMRLPATLVFDSPTPNAVTDFLLSRLLGRQDTAR
PIAKRTAATSEEPLAVIGMACRFPGGVTSPEHLWELVVNGADGVSAFPADRDWDLANLFH
SDPDHPGTSYASEGGFLHDAGEFDPGFFGISPREALAMDPQQRLLLETSWEAVENAGIDP
LSLKGTDTGVFTGLMYHDYSARLRTVPDGLEGYLGTGNAGSVVSGRVAYVLGAEGPAVTV
DTACSSSLVALHWAAQALRQGECSMALAGGVTVMATPSTFVDFSRQRGLAADGRCKSFAA
AADGTGWAEGVGMVLVERLSDAQRLGHPILAVIRSSAVNQDGASNGLTAPNGPSQQRVIR
QALASAGLSTADVDVVEAHGTGTSLGDPIEAQALLATYGQGRPEGQPLWLGSLKSNIGHA
QAAAGVAGVIKMVMALRHGVLPATLHVDEPTPHVDWASGAVELLTESRPWPEVGRPRRAA
VSSFGISGTNAHTILEQAPDAVSGVEDRGAEPETAGVVPWVLSGRGDAGLRGQAARLHEW
ALEHSEERLVDVGHSLVMSRSAFEDRVVVLGSDRDALLDGLAVVAQGDPGPGVVVGSSAG
AGGGVAFLFTGQGAQRLGMGRELAESFAVFAVALDEVCAHMDVLLERPLREVLFAEPGTE
AAALLDETAFTQAALFAVEVALYRLVESWSLTPDYLLGHSIGGLAAAYVSGVLSLEDAAV
VVAARGRLMQALPKGGAMVSLQAAEDEVLESLSGLVSIAAVNGPQAVVISGDEDAVTAVA
EEWRARGRKVKRLTVSHAFHSVLMEPMLAEFEQVLSRVTLNAPRIPVISDSTGLPLTAEQ
ATSPAYWTAHVRNPVLFHQAISYLTEQGVSAFLELGPDGVLSAMTRTSLADDSDTTVVPL
LRSGRQEPEAALTALAELYVNGVAVDWTVLLDGARPVALPTYAFQHQRYWLDATDGPGAD
PADLGLGALNHPLLGAAVGIADGDTAVLTGRVSLGSHPWLADHAVLGSVLLPGTALLELA
VRAGDQVGCARVEELVLHTPLILTEGAGADLQVLVGAADDSGLRTVDIYSRTHTTEQGSY
GTEWTQHASGSLAAEATAPDRTGLETWPPKDATAMEVSGHYERVSESGFDYGPVFQGLRA
AWRDGTDLYAEVALPQSDGTTPAEFGVHPALLDAALHALGLAAGSSDAESTSDLESTAGQ
GQLPFSWGGASLYATGAGTLRVRLRPNQDGTIGLTAIDTAGDLVFAAESLALRPVSAEQI
QAGREAGQDDLFAVDWATALPLPERSGGAPGDWAVLTRFGAHSAQVLLDGLLANGSTGHV
CDDVADAFASDAKPGTVVLPVSRVADPGQDTTEVVSETLAVVQEWLSLPEYAESHLVVVT
EGAVAVEAGEDITDLAGAAVWGLIRTAQSENPDRFILVDIDPAGVRDGVLARAVASDEPQ
LAVRADTLRLPRVRRTGVPAGDGVGTERPVGEPLTGRGTVLITGGTGGLGAVLARHLAAK
GVERLLLTSRQGMAASGADALVAELATLGAAVEIAACDVSDRAAVAALLAGVPDDHPLSA
VVHAAGVLDDGVIGSLTPERVARVLAPKAEGAWHLHELTAHLPLTAFVLFSSASGTFGNA
GQANYAAANAFLDGLAAHRQALGLTAVSLGWGLWAQATGMAGHLGAGEQDRISRGGGDAL
TTEQGLMLFDMALQSDRSTLLPMRLNIQRLQTEANAASPHPLLREIIRVPVRRTTSSASE
SGEAFTDRLSGLSEDEREQAVLDLTRSTVATVLAHNSLEDIPRDKRFLDIGFDSLTAIEL
RNRLNKALGLRLPASLVFDQPTPAQLAKYLVGQLQPSDRSPLMDVLESIDRSLDRALQLR
VSSDPQEEMDSEVLAQLERLANKMTEIKSRGSERMDKSEIRDLSDDEMFNFINKSLNISE
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGTCCAACGAACAGAAGATGTTCGAGTACCTCAAGCGGACGATGGCGGAACTGGAGAAC
AGCCGCTCCCGGGTCGCTGAACTCGAAGGGCGCTCCGCCGAGCCCTTGGCAATCGTTGGT
ATGGCCTGCCGATACCCCGGTGGTGTGACATCGCCGGAGCAGCTCTGGAAGCTGGTGGCC
GAGGGCAGGGACGGAGTCACCGAGTTCCCCACCGACCGTGGCTGGGACATCGAAAACCTC
TACAACCCGGACCCGAACCACCAGGGCACGTCCTACGCCTGCGAGGGCGGCTTCCTGCAC
GACGCAGGCGAGTTCGACCCCGCCTTCTTCGGGATCTCGCCGCGTGAGGCGCTGGCGATG
GACCCGCAGCAGCGTCTCCTCCTGGAGACCTCCTGGGAGGCGGTCGAGAACGCGGGCATC
GACCCACTGATCCTGCGGGGAAGCAGGGCCGGCGTATTCGTCGGCACCAGCAGCCAGGAC
TATGCGGTGACGGCCAATCAGGCTGCGGATGCCACGGACGGCTATCTGCTGACCGGCACC
GCCGGAAGCGTCATATCCGGCCGGGTGGCCTATGTGCTCGGTGCCGAGGGGCCCGCCGTC
AGCGTCGACACGGCGTGCTCGTCATCGCTGGTGGCGCTCCACCTGGCGATGCAGGCGTTG
CGTAATGACGAGTGCTCGATGGCGCTGGTCGGCGGTGTGGCGGTCATGGCCACGCCGACG
GGGTTTGTGGAGTTCAGCCGTCAGCGGGGTCTGGCTGCGGATGGTCGGTGCAAGTCGTTC
GCGGCGGCTGCGGATGGTACGGGCTGGGCCGAAGGTGTCGGTGTGCTCGTGGTCGAGCGG
CTGTCGGTGGCCCAGCGCCTGGGCCACCGGGTTCTCGCCGTGATTCGTTCCAGCGCGGTC
AATCAGGATGGCGCCAGCAGCGGACTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTG
ATTCGTCAGGCACTCGCGTCGGCCGGCCTCTCCACCGCCGATGTGGATGTGGTGGAGGCG
CACGGTACGGGAACGAGTCTCGGTGACCCGATCGAGGCGCAGGCCCTGTTGGCCACGTAC
GGACAGGGTCGGCCGAAGGGCCGGCCGCTCTTGCTGGGTTCGCTCAAGTCCAACATCGGC
CATGCGCAGGCCGCTGCGGGCGTGGCGGGTGTGATCAAGATGGTGATGGCGCTGCGGCAC
GGCGTCCTCCCGGCGACGCTGCATGTGGACGAGCCGACGCCGCATGTCGACTGGGCCAGC
GGCGCGGTGGAACTGCTGACGGAGTCCCGGCCGTGGCCCGAGACGGGCCGTCCGCGCCGG
GCCGCGGTGTCGTCGTTCGGGATCAGCGGTACCAACGCGCACGCGATTCTGGAGCAGGCG
CCGGAGGACGGCACCGCCCAGGTGGCCACCACGGACGGTGACTCCCTGGTGCCGTGGGTG
CTGTCCGGCCGTGGTGCCGCCGGTGTCCGGGCGCAGGCGGCGCGGTTGCGGGAGTGGCTG
CTGGAACGCCCCGGGGCCCACCCGGCGGACATCGGCTCCTCCCTCCTCACCTCCCGGTCG
CTGTTCGAGGACCGGTTGGTTGTGCTGGGGTCGCACCAGGATGTGCTACTCGACGCTCTG
GCGGCGGTTGTTGAGGGTGCGCCGTGGCCGGGTGTGGTGGGTGGGTCGGGTGGTGGTGTG
GTTGCTGATCGGGTGGTGTTCGTCTTTCCGGGTCAGGGGTCGCAGTGGGTGGGGATGGGG
CGTGAGTTGTACACCTCTTCGCCTGTGTTCCGGGCGCGGTTGGACGAGTGTGCTGCCGCG
TTGGATCCGCTGGTGGAGTGGTCCCTGATCGATGTTGTGCGGGGTGAGTCCGGGGCTCCT
GGTCTGGAGCGGGTGGATGTGGTGCAGCCCGTCCTCTGGGCCGTGATGGTCTCCCTGGCG
GCGGTCTGGGAGTCATGGGGTGTGGTCCCGGCCGCTGTGGTGGGTCACTCACAGGGTGAG
ATTGCCGCTGCGTGTGTGGCGGGGGCGCTGTCGGTGGAGGATGCGGCGCGGGTCGTGGCG
TTGCGGAGCCGTGCCGTGCGGGCGATGGCGGGTGACGGCGCGATGGTGTCCGTCGCGCTC
CCCGCCGCCGAGGCTGAGGCGTTGACCGGGGACGGCGTGTCGCTGGCCGCTGTCAACGGA
CCCTCGTCCGTCGTCCTCTCAGGGGACAGATCCGCCCTCACCCCCGTGGTGGAGGGACTG
ACTGCTCAGGGTGTGCGGACGAAGTGGGTGCCGGTGGACTACGCGTCCCACTCGGCCCAT
ATGGAACGCATCCACGACGAGCTACTGGAGATCCTGTCCGGGATCGAGCCCAAGACCTCC
CGTATCCCCCTCTACTCCACGGTGAGCGCTGCTCGTATCGACACATCGCGGATGGACGCC
TCGTACTGGTTCGACAACATCCGGGGCACCGTCCGCTTCCACGAGACCGTCCAGGCCCTG
ATCGCCGACGGACTGACCGCCTTCGTGGAGGTGTCTCCGCACCCCGTTCTGGCGATGAGC
GTTCAGGACACCCTCGACCAGGCCGAAGCCACCGGTCTGTCCATCGGCACCCTCCGCCGC
GACGAGAACGAACACGAGACCCTCCTCACCGCCGCCGCCCAACTCTTCGTCGCCGGCCTC
CCCATCGACTGGCACACGGCGGCTTTCACCGGCCGGGAAACCCGCCGCGTCGACCTCCCC
ACCTACGCCTTCCAACGGGAGCGCTTCTGGCTGGAGGCCGGCACAGCGATAGCCGAGGTC
GCCGCAGTCGACGGCGCAGAGGCACGCTTCTGGGACGTGGTCGAGCGCGGAGACGCCGAG
GAATTGGCGGCGGCCCTCGCGGCAGCAGGAGTGGACGCGTCGGTAGAGGCATTGGAGCCC
GTGCTGCCCGTGCTCTCTTCTTGGCGGCAGGTCCAGCGCGCCCGTACCGCTGCCCAGTCC
TGGCGCTACCAGGTGACATGGAAGCCGCGGACCGGCGCGGCGACGGATGGGAGCCTGTCC
GGCACCTGGTTGGTCCTCGCACCCCAGCCGGGCAGCTTCGACGGACTCACCGCGGAGTGC
GTATCGGCGCTGGAGGAGCGCGGCGCCACCGCCGTCGTCCTCCGCCCCGATGGCCCCGCA
GTGGGTGACCGCGCGAGCTGGCGTGCCCTGCTCGACGGCGCACTGGCCGACACTCCTGAT
CAGCCGGTGTCCGGCGCCGTCGCCCTATTGGGCCTGGCCGAAGACCCGCTGACGGAGTTT
CCCGTCGTCTCCGCCGGTCTCGCCGGGGTACTGGCCCTCGTCCAAGCCCTGGGTGACGTG
GGCATTGAGGCCCCGATGTGGTGCCTAACCCAGGGTGCAGTCTCCGTCGGCCGGACAGAC
CCCGTCCGCCATCCCACTCAGGCGCTGGTCTGGGGCCTTGGCCGGGTCATCCCGCTGGAG
GCTCCCCAGCGCTGGGGCGGCCTGATCGACCTGCCGGAGACGGTCGACCAGAGTTGCTGG
GACCGAATCGGGTCCGCGCTGGCGGGTGACGGAGGCGAGGACCAGATCGCGATCCGTACA
TCCGGTACGTACGTTCGCCGTCTCGTCACCGCACCGGCGTCGGACCGTGCCACGTCCGGC
GGATGGACGCCCGGCGACGGAACCGTACTGATCACCGGTGGGACGGGTGCGCTGGGCCGG
CATGTGGCCCGATGGACGGCGAGTCGTGGCGCCCGGCGCCTGCTGCTGCTCAGCCGTAGT
GGCCATCGCGCTCCCGAAGCCGAAGCTCTGGTGGCGGAGCTGTCGGAGGCCGGGTGCCAC
GCGGATGTGGTCGCCTGCAACATCGCCGACCGCGACGCCCTCGCCACCGTCCTGGCCGCG
ATTCCCGCCGAGCACCCCCTGACCACCGTGATCCACACGGCAGCCGCGCTCGATGACGGG
GTGATTGACTCCCTGAGCCCGAGCCGGATGGCGGCGGCGCTGCGTGCGAAGAAGGCCGGG
GCGTGGAATCTGCACGAGCTGACCAGCGAGCTGGACCTCGCGCACTTCGTGTTGTTCTCG
TCGTTCGGTGCGGTGGTCGGCTCGCCCGGTCAGGGCAACTACGCTCCCGCCAACGCGTAC
CTGGATGCCCTGGCCCAGTACCGCCGCTCCCACGGCCTGGCCGCGACTGCGATCGCCTGG
GCGGCCTTGGCGGGTGACGGGATGGCCCGGGAGAGCGACATCTTCGACCGGTTCGCGCGG
CACGGCGTTCCGCCGATGTCCCCGGAGCAGGCGCTGGAGGCCCTCGGGGTGGCGCTGGCC
GGGGACGAGACCTGCGTCTCGATCGCAGACATCTCATGGAAGCAGTTCTGGACCGCGAAC
AACGCCGAGCGCGCCAACCTGTTCTTCAACGAGATCCCCGAGGTCCAGGCGCTGCTGGCG
GAGCACGCCGCCACCACGGACTCCGGGTCCGGACTGGCCGCCCGGCTCGTCGGACTCGCA
GGACCTGAGCGGCACCGTACGCTGCTGGATCTGGTACGGGGCCATGTCGCGGCGGTCCTC
GGGCACAGCGGCCCCGAGAACGTGGCTGCGGGGCGGGCCTTCCGCGAACTCGGCTTTGAC
TCGCTCACCGCCGTAGAACTGCGGAATCGCCTCAACGCCGCCACCGGGCTCCAGTTGTCG
GCCACCCTCGTCTTCGACTATCCGACACCGACGATCATCACGGAGCACCTGCTCGGCCAA
TTGCTCGGCGAGGGCGAGGGCGAGGGCGAGGGCGACGGTGAGGACGAGAATGGCGCTGTC
GCTCGGCCGCGGCCTACGGCGGCACACGTCAGTAACGAGCCGCTGGCCGTCGTGGGTATG
GCCTGCCGCTTCCCAGGTGGGGTGGCAACCCCCGAACAACTGTGGCGGCTGGTCGCCGAG
GGAGTGGACGGCATCAGTGGATTCCCAGTCGATCGCGGCTGGGACGAGCGGGCGCTGTTC
GACCCCGATCCCGACAACCAGGGCACCACTTATGCCTGCGAAGGTGGCTTCCTGCACGAC
GCGGCCAAGTTTGATCCCGAGTTCTTCGGGATCTCGCCGCGCGAGGCATTGGCGATGGAC
CCTCAGCAGCGTCTTCTTCTGGAGACCTCCTGGGAGGCCGTGGAGAACGCGGGCATCGAC
CCGCTCACCCTGCGCGGCAGCGCCACCGGAGTCTTCGCCGGAGTCACCTACCACGACTAC
TCCGCCCGGTTGCGGTCGATACCCGAGGGCCTGGAGGGGCTGCTGAGCACGGGCAGCTCC
GGCAGCGTGGTCTCGGGCCGAGTCGCCTATGTCTTGGGTCTTGAGGGTCCGGCGCTGACG
GTGGATACGGCGTGTTCGTCGTCGTTGGTCGCGTTGCATCTGGCGGGCCAGGCGCTGCGG
CAGGGTGAGTGCTCCATAGCGCTCGCCGGTGGCGTCACCGTCATGTCCACTCCGGGGACG
TTCATCGGCTTCAGTCGTCAGCGGGGTCTGGCGGCGGATGGTCGGTGCAAGGCGTTCGGA
GCGGCGGCGGACGGATTTGGCCCGGGCGAGGGCGTGGGCATGTTGGTCCTGGAGCGGTTG
TCGGATGCCCAGCGTCTCGGCCATCCCGTCCTCGCTGTCATCCGGGGCAGTGCGGTGAAT
CAGGACGGTGCCAGTAATGGTCTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATT
CGTCAGGCCCTGGCCTCTGCCGGTCTCTCCACCGCTGATGTGGATGTGGTGGAGGCACAC
GGTACGGGAACGAGTCTCGGTGACCCGATTGAGGCGCAGGCCCTGCTGGCGACCTACGGT
CAGGGCCGTCCTGAGGATCGGCCGCTGAGGCTGGGCTCGATCAAGTCGAACATTGGGCAC
ACTCAGGCGGCTGCCGGTGTCGCCGGTGTGATCAAGATGGTGATGGCCCTACGGAACGGG
GTCCTTCCGCCCACGCTGCATGTGGACGAGCCGACTCCGCATGTGGATTGGGCGAGCGGT
GCGGTTGAGCTGCTGACGGAGGCTGCCTCCTGGCCCGAGGTGGACCGTCCGTGGCGCGCG
GCAGTCTCCTCCTTCGGCATCAGTGGTACCAACGCTCACACGATCATCGAGCAGGCCCCT
CAGGTGGAGGTCGGGGCTCTCGAGCCGGCCGTGAAGGGCGATGTCCTGGTGCCGTGGGTG
GTGTCGGGGCGTGGTGCGGACGCGTTGCGGGCGCAGGCCGCTCGGCTGCGGGAGTGGGTG
CTTGAGCACCCTGAGCACAGCTTGGTTGATGTTGGTCATTCGTTGGTGGTGTCGCGGTCG
GCTTTTGAGGATCGGGCGGTTGTTCTCGGTTCGGATCGCGAGGCGTTGTTGGATGGTCTG
GCGGCGGCTGCTCAGGGTGGACCCTGGCCCGGTGTCGTGCAGGGTTCGTCTGTCGGGTCC
GGTGGTGGGGTGGCGTTCCTGTTTACCGGGCAGGGCGCACAGCGCGTCGGCATGGGCCGT
GAACTCTCCGTACGTTTCCCGGTGTTCGCGTCCGCGCTGGACGAGGTCTGCGTTCAGCTC
GACGCCCATCTGGAACGTCCGCTACGTGAAGTGCTCTTCGTCGAACCTGACACCGAGGCT
GCGGCGCTGCTGGACGAGACGGCTTTCACCCAGGCAGCCCTGTTTGCCATTGAGGTCGCG
CTCTATCGGCTGGTGGAGTCGTGGTCCCTGACGCCGGACTATCTCCTGGGTCACTCCATC
GGTGGTCTGGCCGCGGCGCATGTGGCGGGTGTGCTGTCGTTGGAGGACGCGGCCGAGGTG
GTGGTGGCTCGGGGTCGGTTGATGCAGGCCCTGCCCAAGGGCGGAGCCATGGTCTCCCTC
CAGGCGTCGGAAGACGAGGTCGTCGAGTCGCTGGACGGCCGGGTGTCGATCGCCGCGGTG
AATGGTCCGCAGGCGGTCGTCATCTCCGGAGACGAAGACGCCGTCACAGCGGTGGCGGAC
GAATGGCGGGCCCGGGGCCGGAAGGTGAAGCGCCTCACGGTCAGCCACGCCTTCCACTCG
GCACTGATGGAGCCAATGCTCGCCACCTTCGAACAGGTCCTGTCTCGGGTCACGCTGAAC
CCGCCGCGGATCCCGGTCATCTCCGACTCCACCGGCCTACCCCTCACACCGGAGCAGGCC
ACCTCTCCCGCGTACTGGACCGCCCACGTCCGTAACCCGGTCCTGTTCCACCAGGCCATC
ACCCACCTCACCGGCCAAGGCGTGAACAGCTTCCTGGAACTGGGCCCCGACGGCGTACTC
AGCGCCATGGTCCAGCACAGCGCCCCGGACGCCGCACAGGCCACCCCGCTCCTCCGCTCG
GGTGTCGACGAGCCCGAGGCGGCGCTGACCGCCGTGGCCGGACTCTTCGTCACTGGCCGT
ACCCTGGACTGGAACGCGGTCCTCGCCGACCCCGGCGCCCGCCGGGTCCCGCTGCCGACC
TACTCCTTCCAGTACGGCCACTACTGGCTGAAGACGGACACCACCCCCGGCGCAGACGCG
GCCCTGCACGGACTCGCCTCGCTCCAGCACCCCCTGCTGAGTGCCTGCGTCACCGTGGCC
GAGGGTGATCTGGTGCTGTTGACCGGCCAACTCTCCCTGCGTAACCACCCCTGGCTGGCC
GACCACGCCGTCCTCGGCTCCGTACTCCTGCCCGGCACCGCCTTCCTGGAACTGGCCGTA
CGCGCCGGTGACCAGGTCGGCTGCGCCCGCGTCGAAGAACTGGTCATCCAGGCCCCGCTG
ATCCTCGCCGACGACGACACCGCAGCACCGCAGGACGTACAGATACTGGTCGGAGCCCCC
CAGCCGGACAGCGCCCGATCCGTCGACATCTACTCCCGCCCCCACACCGACGGTGACGCC
GGGCCGGACCACGATGCCTGGACCCACCACGCCAGCGGGGTACTGACCACCGGGAGCCGA
GGCGAGAGCAGCGTCGCCCCCGACACCTCACTCACCACCTGGCCGCCGCAGCAGGCCGTA
CCCATCCCGCTGGACGACTTCTACCCCCGCCTCGACCGGCTCGGCTTCGGCTACGGCCCG
CTCTTCCAGGGCCTGCACGCGGCCTGGCGCAGCGGTGACGAGGTGTACGCCGAGATCCGG
CTGCCGGAACAGGACGACGACACGGCCGGCGGCACCGACTTCGGTATCCACCCCGCACTG
CTCGACGCCGCCCTACACGCCATCAGCCTCACCGTCCCCGAGCAGGCCGACGATTCCGAC
ACCCCTCAGGGCGGACTGCCGTTCTCCTGGACCGGAATCGAACTGCACGCCGGAGGCGCC
GCCGCCCTGCGGGTCAGGTTGCGCCGCAACGACGACGACTCGGTGAGCCTGCTCGCGGCG
GACGCCGTCGGCGCGCCGGTCGTGTCGGTGGAGTCGCTGGTGCTGCGCCCGGTCACCGCG
GAGCATGTCCGTGCCGATCGGAGCGCGCACCGCGACGCGCTGTTCAACCTGGACTGGGTC
CTGGGCGAGGCGGCTCCGGATCCGCGTGAGTCCACCTGGGGCATCCTGACCGTCCCGGGC
CTCACCACCGGCACCGAGGACGTCGAAGCGGGCCTGACACTGCGGGGCGTCACGGTCTCC
GAACTCGCAGGCATCCCCGTCGTACCTTCCGAAACGGGTCCGCTCCCGCAGGACAGCCGG
CCCGCCCCCGACACCGTGGTCGTGCCCCTGTCCTTCACCGATAACGGCACAGCCGCGACG
GCCGTCACCACCACGCTGGCCGTGGTGCAGCAGTGGCTGGCCTCCCCCGAATGGTCGGCC
TCCCGGCTGCTGGTGCTCACCCGTGGAGCAGTGGCGGTTGAACCCGGTGAGGACGTTACC
GACCTCGCAGCCGCGGCGGTGTGGGGTCTGCTCCGTACGGCACAGTCCGAGAACCCGGAC
CGGTTCCTGCTGGTCGACAGTGACGAACGGGGCATTGACGGAGGTTCGCTGCTGGAGGCT
GTCGCCGCCGATGAGCCGCAGATCGCTCTCCGGGACGGACGGATCCGACTGCCGCGCCTG
CACCGCGCACAGCTCGATGAGGACTGCGAGCGTCACGACTGGAGCGCCACTCCCGGCACC
GTACTGGTGACGGGAGGGACGGGCAGCCTCGGTCAGGCCGTCGCCGCCCATCTGGCGGAC
CAGGGAGTCAGCAGACTGCTGCTGCTCAGCCGCCGTGGCCCGGACGCCCCCGGCGCCGGT
GAGCTGGTGGAACGGTTGAACGCGGCCGGAGCCGCGGTCGAGATCGTCGCCTGTGACGTC
GCCGACCGGGAGGCACTGGCCGGCGTCCTCGCCGGGATCCCCCCGGAGCATCCGCTGTGC
GCGGTCGTGCACACCGCCGGCGTCGTCAGCGACGCGACCATTCCGTCCCTGACACCGGGG
CAGGTCGCCGCGGTCTTCGCCGCCAAGGGCGACGCCGCGTGGCATCTGCACGAGCTGACG
GCGGAGACACCACTGTCCGCGTTCGTGCTCTTCTCCTCCGCCTCCGGCACGATCGGAAAC
GCGGGCCAGGGGAACTACGCCGCCGCGAACGCGTTCCTTGACGCGCTGGCCCGGCACCGT
AGCGCCCGTGGACTGCCTGCCGTATCGCTCGGCTGGGGCCTGTGGGCCGAGCCCAGTGGT
ATGACCGGCGGGCTGAGCGGCGCCGACCGCGCCCGGATGGCCCGTGGCGGGGTCACGGCA
CTCACCACCCGTCAGGGTCTGGAACTCCTCGACACGGCGCTCGGTGCCGGTACGCCGTGG
ATGCTGCCGATCAAGCTCAATCTACGCGCGCTCCGGGGCTCGGTCGCCGTTCCGCATCTG
CTGCGGGACCTGGCCCCGGCCTCCGTACGACGCCACGCCACCGCCGGATCGGAGAACGCC
GGCACCCTGGCGGCCCGACTGGCGGGACTGGCCGAGACTGAGCAGCGCCAACTACTGCTG
GAAACCGTACGGGGGCAGGTCGCCACCGTCCTCGGTCACGCCAGGCCGGAACACATCCAG
CCCGAGCGTGCCTTCCGAGAGCTGGGATTCGACTCCCTGACCTCGGTGGAGTTGCGGAAC
CGGCTCAACACGGCCACCGGAATGAGACTGCCCGCCACCCTGGTCTTCGACTCGCCGACC
CCGAACGCAGTGACGGACTTCCTGCTCTCCCGACTCCTCGGACGGCAGGACACCGCGCGG
CCGATAGCGAAGCGAACCGCCGCCACCAGTGAAGAGCCCCTGGCCGTGATCGGAATGGCC
TGCCGTTTCCCCGGCGGGGTCACCTCACCGGAGCATCTCTGGGAGCTGGTCGTCAACGGC
GCTGACGGAGTCTCCGCCTTTCCGGCTGACCGTGACTGGGACCTGGCCAACCTCTTCCAC
TCCGACCCTGACCACCCCGGTACCAGCTATGCCAGCGAGGGCGGCTTCCTGCACGACGCA
GGCGAGTTCGATCCCGGCTTCTTCGGGATCTCGCCGCGCGAGGCCCTGGCGATGGATCCG
CAGCAGAGGCTCCTCCTGGAGACCTCCTGGGAAGCGGTCGAGAACGCCGGAATCGACCCG
CTCTCCCTCAAGGGCACCGATACGGGCGTGTTCACCGGGCTGATGTACCACGACTACTCG
GCCCGGTTGCGTACGGTGCCGGACGGTCTCGAAGGCTACCTGGGCACGGGTAACGCGGGC
AGCGTGGTCTCCGGCCGGGTGGCGTATGTCCTCGGTGCCGAGGGTCCGGCGGTGACGGTG
GACACGGCGTGTTCGTCGTCGCTGGTCGCCCTGCACTGGGCGGCGCAGGCACTGCGTCAG
GGCGAGTGCTCGATGGCACTCGCCGGCGGCGTCACCGTCATGGCCACACCGAGTACCTTC
GTCGACTTCAGCCGTCAGCGGGGTCTGGCGGCCGATGGCCGGTGCAAGTCGTTCGCGGCG
GCTGCCGACGGTACGGGCTGGGCCGAGGGCGTCGGTATGGTGCTGGTCGAGCGGCTGTCT
GACGCGCAGCGACTGGGCCACCCGATCCTCGCCGTGATTCGTTCCAGCGCGGTGAATCAG
GACGGTGCGAGCAATGGTCTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATCCGT
CAGGCGCTCGCGTCGGCCGGTCTCTCCACCGCCGATGTGGATGTGGTGGAGGCGCACGGT
ACGGGGACGAGCCTGGGGGACCCGATCGAGGCGCAGGCTCTCCTGGCGACGTATGGGCAG
GGACGGCCGGAGGGACAGCCGCTGTGGCTGGGTTCGCTGAAGTCGAACATCGGCCACGCG
CAGGCCGCAGCCGGTGTGGCGGGTGTGATCAAGATGGTGATGGCGCTGCGGCACGGCGTC
CTCCCGGCGACGCTGCACGTGGACGAGCCGACCCCGCATGTTGACTGGGCGAGCGGTGCG
GTGGAGCTGCTGACGGAGTCCCGGCCGTGGCCTGAGGTGGGTCGTCCGCGTCGGGCTGCG
GTGTCGTCGTTCGGTATCAGCGGCACCAACGCCCACACCATCCTGGAGCAGGCCCCCGAT
GCGGTGAGCGGAGTGGAGGACAGGGGGGCGGAGCCCGAGACTGCTGGAGTGGTGCCGTGG
GTCCTTTCCGGCCGCGGCGACGCCGGTCTCCGGGGGCAGGCGGCCCGGTTGCATGAGTGG
GCTTTGGAGCACTCTGAGGAGCGCTTGGTCGATGTTGGTCATTCGTTGGTGATGTCGCGG
TCGGCTTTTGAGGATCGGGTGGTTGTTCTCGGTTCGGACCGGGACGCGCTGTTGGACGGT
CTGGCGGTGGTTGCTCAGGGTGATCCGGGGCCGGGTGTGGTGGTGGGTTCGTCCGCTGGT
GCTGGTGGTGGTGTGGCGTTCCTGTTCACGGGGCAGGGTGCGCAGCGGCTGGGTATGGGT
CGTGAACTCGCGGAAAGTTTTGCGGTGTTCGCTGTGGCGTTGGATGAGGTCTGCGCTCAT
ATGGATGTTCTTCTGGAGCGTCCGTTGCGTGAGGTGTTGTTCGCGGAGCCCGGCACTGAG
GCTGCGGCGCTGCTGGACGAGACGGCGTTCACTCAGGCAGCCCTGTTTGCCGTTGAGGTT
GCGCTGTATCGGTTGGTGGAGTCGTGGTCGCTGACGCCGGACTATCTTCTGGGTCACTCC
ATCGGTGGTCTGGCCGCGGCGTATGTGTCGGGTGTGTTGTCGTTGGAGGACGCGGCCGTG
GTCGTCGCGGCTCGGGGTCGGTTGATGCAGGCCCTGCCCAAGGGCGGAGCCATGGTCTCC
CTCCAGGCCGCTGAGGACGAGGTCCTGGAATCGCTCAGCGGTCTGGTGTCGATTGCCGCG
GTGAATGGTCCGCAGGCGGTTGTCATCTCCGGTGACGAGGACGCTGTCACCGCTGTGGCG
GAGGAGTGGCGGGCCCGGGGTCGGAAGGTGAAGCGCCTCACGGTCAGTCATGCTTTCCAC
TCGGTGTTGATGGAGCCAATGCTCGCCGAGTTTGAGCAGGTCCTGTCTCGGGTCACGTTG
AACGCCCCGCGGATTCCGGTCATCTCCGACTCCACCGGTCTGCCCCTCACGGCGGAGCAG
GCCACCTCTCCCGCGTACTGGACCGCCCACGTCCGTAACCCGGTCCTGTTCCACCAGGCC
ATCTCCTACCTCACCGAGCAGGGTGTGAGTGCCTTCCTGGAGTTGGGCCCCGACGGCGTA
CTCAGCGCCATGACCCGCACGAGCCTGGCCGACGACAGCGACACCACGGTCGTCCCCCTG
CTGCGGTCCGGCCGCCAGGAGCCGGAAGCTGCACTGACCGCGCTGGCCGAGCTGTATGTC
AACGGCGTGGCCGTCGACTGGACCGTACTCCTCGACGGAGCCCGCCCGGTTGCCCTGCCG
ACCTACGCCTTCCAGCACCAGCGTTACTGGCTCGACGCCACGGACGGCCCCGGCGCCGAC
CCGGCCGACCTCGGCCTGGGCGCCCTGAACCACCCGCTGCTCGGTGCGGCGGTCGGGATC
GCGGACGGCGACACCGCGGTGCTCACCGGACGGGTATCGCTCGGCTCGCACCCTTGGCTG
GCCGACCACGCCGTCCTCGGCTCCGTACTCCTGCCCGGCACCGCCCTCCTGGAACTGGCC
GTACGCGCCGGTGACCAGGTCGGCTGCGCACGCGTCGAAGAGCTGGTGCTCCACACCCCG
CTGATCCTCACCGAAGGCGCCGGCGCGGACCTTCAGGTCCTGGTGGGCGCCGCCGACGAC
AGTGGCCTCCGCACGGTGGACATCTACTCCCGTACACACACCACCGAACAGGGCTCGTAC
GGCACGGAATGGACCCAACACGCCAGTGGTTCCCTCGCCGCCGAGGCCACCGCGCCCGAC
CGGACCGGGCTGGAGACCTGGCCGCCGAAGGACGCCACCGCCATGGAGGTGAGCGGCCAC
TACGAGCGCGTAAGCGAGTCCGGGTTCGACTACGGCCCGGTGTTCCAGGGCCTGCGGGCC
GCCTGGCGGGACGGCACCGATCTCTACGCCGAGGTCGCGCTCCCGCAGAGCGACGGCACC
ACCCCGGCCGAGTTCGGAGTGCACCCCGCACTGCTCGACGCCGCGCTGCACGCACTCGGT
CTGGCCGCGGGCAGCAGTGACGCTGAAAGCACCTCTGACTTGGAGAGCACAGCCGGGCAG
GGGCAACTTCCCTTCTCCTGGGGCGGAGCCTCCCTCTACGCCACGGGCGCCGGAACACTG
CGCGTACGCCTCCGCCCCAACCAGGACGGCACTATCGGACTGACCGCCATCGACACCGCC
GGTGACCTGGTGTTCGCCGCTGAGTCGCTGGCGCTGCGCCCGGTGTCGGCGGAGCAGATC
CAGGCCGGTCGGGAGGCCGGTCAGGACGATCTGTTCGCGGTCGACTGGGCCACGGCCCTA
CCGCTCCCCGAGCGGTCCGGCGGCGCGCCGGGGGATTGGGCCGTACTGACGCGGTTCGGT
GCGCACTCGGCCCAGGTGCTGCTCGACGGGCTACTCGCCAACGGGTCGACCGGCCACGTA
TGTGACGACGTCGCCGACGCCTTCGCCAGTGATGCGAAGCCCGGAACCGTGGTGCTGCCC
GTGAGCCGAGTGGCCGACCCGGGGCAGGACACGACCGAGGTGGTCTCCGAGACGCTGGCG
GTGGTGCAGGAATGGCTGTCATTGCCGGAGTACGCGGAGTCCCACCTGGTGGTGGTCACC
GAGGGCGCGGTGGCCGTTGAGGCGGGCGAGGACATCACCGACCTGGCGGGTGCCGCTGTC
TGGGGGCTGATCCGAACCGCCCAGTCGGAGAATCCGGACAGGTTCATCCTGGTCGACATC
GACCCCGCGGGCGTACGCGACGGAGTCCTGGCCCGGGCAGTGGCCTCGGACGAACCGCAG
CTCGCCGTCCGTGCCGATACCCTCCGTCTGCCCCGGGTGCGCAGGACCGGCGTCCCGGCC
GGGGACGGAGTGGGTACGGAGCGGCCGGTCGGGGAACCGCTGACTGGCCGGGGAACCGTC
CTGATCACCGGCGGTACGGGTGGACTCGGAGCGGTGCTGGCCCGTCATCTCGCCGCGAAG
GGAGTGGAACGACTGCTGCTGACCAGCCGTCAAGGCATGGCCGCCAGCGGGGCGGACGCG
CTGGTAGCGGAGCTGGCGACACTGGGAGCTGCGGTGGAGATCGCGGCATGTGACGTCTCC
GACAGGGCGGCAGTTGCCGCACTGCTGGCAGGAGTGCCCGACGACCACCCGCTGTCCGCG
GTGGTGCACGCGGCGGGCGTACTGGACGACGGTGTGATCGGTTCGTTGACTCCGGAGCGG
GTGGCCCGTGTCCTCGCACCGAAGGCCGAAGGCGCCTGGCATCTACATGAACTGACGGCT
CATCTACCGCTGACCGCGTTCGTCCTCTTCTCCTCGGCGTCCGGGACGTTCGGCAACGCG
GGTCAGGCCAACTACGCCGCCGCCAATGCCTTCCTGGACGGTCTGGCCGCCCACCGACAG
GCACTCGGACTCACAGCGGTCTCCCTGGGCTGGGGGTTGTGGGCACAGGCCACGGGCATG
GCAGGACATCTGGGCGCGGGTGAGCAGGACCGGATCAGCAGGGGCGGCGGGGACGCTCTC
ACCACGGAGCAGGGCCTGATGCTGTTCGACATGGCACTGCAATCCGATCGAAGCACCCTC
CTGCCTATGCGGTTGAATATCCAACGTTTGCAGACCGAAGCCAACGCCGCGTCCCCGCAC
CCGTTGTTGCGTGAAATCATCAGGGTTCCAGTGCGTCGTACAACCAGTAGCGCGAGTGAA
TCGGGCGAAGCATTTACCGACCGTCTCTCCGGGCTTTCCGAGGACGAAAGGGAACAAGCG
GTGCTCGATCTGACGCGATCCACCGTCGCGACTGTGCTTGCTCACAACAGCCTCGAAGAT
ATCCCTCGCGATAAGAGGTTCCTTGATATAGGCTTCGACTCGCTTACCGCGATCGAGCTG
CGCAATCGCCTTAACAAGGCGCTCGGTCTGCGGTTGCCGGCCAGTCTGGTCTTCGACCAA
CCGACCCCGGCACAGTTGGCGAAGTACCTCGTCGGGCAACTTCAACCGAGCGACCGCTCG
CCGCTCATGGACGTCCTCGAATCGATCGACCGAAGTCTCGACCGCGCCCTGCAACTGAGG
GTTTCCTCGGACCCGCAGGAAGAGATGGACAGTGAAGTCCTCGCGCAACTGGAACGTCTG
GCCAACAAGATGACGGAGATCAAGTCTCGTGGCTCGGAACGGATGGACAAGAGCGAAATC
CGGGACCTGAGCGACGATGAGATGTTCAATTTCATTAACAAGTCGCTGAACATCTCCGAG
TAG
[7] KS34..410
[7] AT566..880
[7] methylmalonyl-CoA754..758
[7] KR1207..1386
[7] ACP1488..1558
[8] KS1593..1969
[8] AT2126..2439
[8] malonyl-CoA2316..2320
[8] DH2490..2665
[8] KR2999..3178
[8] ACP3279..3349
[9] KS3372..3748
[9] AT3907..4225
[9] malonyl-CoA4097..4101
[9] DH4271..4438
[9] KR4778..4957
[9] ACP5061..5131
[7] KS100..1230
[7] AT1696..2640
[7] methylmalonyl-CoA2260..2274
[7] KR3619..4158
[7] ACP4462..4674
[8] KS4777..5907
[8] AT6376..7317
[8] malonyl-CoA6946..6960
[8] DH7468..7995
[8] KR8995..9534
[8] ACP9835..10047
[9] KS10114..11244
[9] AT11719..12675
[9] malonyl-CoA12289..12303
[9] DH12811..13314
[9] KR14332..14871
[9] ACP15181..15393

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [563-689]  G3DSA:3.40.366.10 [754-871]  G3DSA:3.40.366.10 [2121-2251]  G3DSA:3.40.366.10 [2316-2431]  G3DSA:3.40.366.10 [3897-4032]  G3DSA:3.40.366.10 [4097-4214]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1516-1531]  PS00012 [3307-3322]  PS00012 [5089-5104]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1481-1609]  1.29999924468179e-25 SSF47336 [3272-3388]  1.60000240695997e-28 SSF47336 [5052-5138]  1.89999859865865e-21 SSF47336
SSF47336   ACP_like
 [1486-1561]  1e-65 G3DSA:1.10.1200.10 [3276-3352]  1e-65 G3DSA:1.10.1200.10 [5059-5135]  1e-65 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1488-1558]  PS50075 [3279-3349]  PS50075 [5061-5131]  PS50075
PS50075   ACP_DOMAIN
 [1491-1556]  8.80000000000003e-10 PF00550 [3282-3348]  4.3e-12 PF00550 [5067-5130]  1.2e-11 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1207-1384]  1.09999999999999e-60 PF08659 [2999-3177]  2.59999999999998e-62 PF08659 [4778-4956]  2.80000000000001e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  4.49999999999996e-95 PF00109 [1593-1843]  4.59999999999996e-96 PF00109 [3372-3622]  1.9e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  2.8e-47 PF02801 [1851-1969]  3.40000000000004e-49 PF02801 [3630-3748]  9.40000000000003e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [566-880]  2.09999999999996e-106 PF00698 [2126-2439]  1.5e-61 PF00698 [3907-4225]  2.89999999999999e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [2-34]  9.20000434662057e-06 SSF101173
SSF101173   Polyketide_synth_docking
 [1-27]  5.8e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [564-863]  1.50000965748778e-73 SSF52151 [2124-2433]  2.0000139277205e-66 SSF52151 [3904-4219]  4.69998262513189e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [691-753]  2.70000183580794e-16 SSF55048 [2253-2315]  6.79998707392904e-18 SSF55048 [4034-4096]  3.89999861795218e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-296]  G3DSA:3.40.47.10 [298-462]  G3DSA:3.40.47.10 [1596-1855]  G3DSA:3.40.47.10 [1856-2021]  G3DSA:3.40.47.10 [3375-3634]  G3DSA:3.40.47.10 [3636-3800]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  7.80005155399507e-102 SSF53901 [1585-1967]  1.79999754022378e-104 SSF53901 [3364-3746]  1.90000694315261e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1207-1392]  1.5e-109 G3DSA:3.40.50.720 [2992-3181]  1.29999999999998e-101 G3DSA:3.40.50.720 [4778-4986]  7.5e-103 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1756-1772]  PS00606 [3535-3551]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [568-862]  2.60002801425225e-129 SM00827 [2127-2422]  3.49999466863949e-116 SM00827 [3908-4205]  3.99998544139406e-115 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1489-1561]  1.70000295590053e-34 SM00823 [3280-3352]  6.4999795054176e-34 SM00823 [5062-5134]  4.00000300869883e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2490-2665]  4.40002866058555e-78 SM00826 [4271-4438]  7.00003808422647e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1595-2021]  SM00825 [3374-3800]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1207-1386]  1.40000506907309e-54 SM00822 [2999-3178]  4.19999771339582e-55 SM00822 [4778-4957]  4.10001399699315e-65 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit