close all open/close all

CDS information : Halsto_00050


close this sectionLocation

Organism
StrainHC34
Entry nameHalstoctacosanolide
Contig
Start / Stop / Direction66,650 / 78,079 / + [in whole cluster]
66,650 / 78,079 / + [in contig]
Location66650..78079 [in whole cluster]
66650..78079 [in contig]
TypeCDS
Length11,430 bp (3,809 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)hlsE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16568718] The complete biosynthetic gene cluster of the 28-membered polyketide macrolactones, halstoctacosanolides, from Streptomyces halstedii HC34. (J Antibiot (Tokyo). , 2006)

close this sectionPKS/NRPS Module

13 methylmalonyl-CoA
14 malonyl-CoA
KS33..409
AT564..878
DH929..1095
ER1430..1745
KR1754..1933
ACP2037..2107
KS2131..2506
AT2666..2990
kr3320..3499
ACP3644..3714

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MESKELIEALRDSLKEIQTLKDEKAEILEKQGEPLAVIGMACRFPGGVSSPEQLWNLVVS
GGEGISGFPTNRGWDTGNLYDPETQRQGTSYTQEGGFLHDAGQFDPGFFGISPREALAID
PQQRLLLETSWEAIESAGIDPMSLRGSATGVFTGLSYHDYLSQIGSVPDELEGYLGTGNA
GSVASGRVAYVLGTEGPAVTVDTACSSSLVALHLAAHALRQGECSMALAGGVTVMATPGA
FVDFSRQRGLAEDGRCKAFSAAADGTAWAEGVGTLLVERLSDAQRLGHPILAVVRSSAVN
QDGASNGLTAPNGPSQQRVIRQALAAADLSTADVDVVEAHGTGTTLGDPIEAQALLATYG
QGRPEGRPIRLGSLKSNIGHTQAAAGVAGVIKMVLALRHGVLPATLHVDEPSPHVDWASG
AVELLTEATPWPETGRPRRAAVSSFGVSGTNAHVILEQALDDGDTEVSTTDDESLVPWVL
SGRGADGVRAQAARLREWLLERPEDRPVDVGFSLLSSRSVFEDRLVVLGSQREALLDGLA
AAAEGAPWPGLVQSSGDVSLNRAVFVFPGQGSQWVGMGRELYASSPVFRGRLDECAAALD
PLVDWSLIDVVRGESGAPGLERVDVVQPVLWAVMVSLAAVWESWGVVPAAVVGHSQGEIA
AACVAGALSVEDAAQVVALRSRAVRAMAGDGAMVSVALPAAEAEALTGDGVSLAAVNGPS
SVVLSGDRSALTPVVERLSAEGVRTKWVPVDYASHSAHMERIREELASLLSGIEPRTSRI
PLYSTVSAARIDTSRMDASYWFDNIRGTVRFHETVQALIADGLTAFVEISPHPVLAMSVQ
DTLDQAEATGLSIGTLRRDENEHEAFLTAAAQLFVAGLPIDWNTAAFTDLDTRRVDLPTY
AFQRDWFWLSGRAGAVGDVGSLGLGAVGHPLLGAAVSVAEGDVVVLTGRVSLGSHPWLAD
HVVLGSVLLPGTAFVELAVRAGDQVGCGRVEELVLHAPLVLTGDEAVDVQVVVGAEESGF
RSVDIYSRPHSESGWQDQDAWTHHAVGTVTAGTEDPADADLSVWPPRDATPVVIEDFYAQ
LDASGYGYGPAFRGLRAAWRRGDEVFAEVELPESERDTAAEFGLHPALFDAALHGTGLMG
SREKGMLPFSWNGVSLHASGASVLRVRLRSAADDAIEVLATDVTGAPVLSVGSLVLRSVT
ADQVRANEQRDLYEVQWGPFAGPVGVSGRDVGEWAVLDLPELGGGVGAVVEGLVACDVAV
RVVGRESFAGGGSLPETLIVPVVGGGGDAVDVVCGVLGVVREWLGLVGGVSRLVVVTWGA
VSVGSGEGVGDVGGAGVWGLLRSAQSEHPGRFVLVDVEGVEGVGWGGLVDGVVCGEGQVV
VRGGGLLVPRLVRAGGGGLVIPETFTGGAEVVGGVGSGWCVGVGVGSGVGTLEGLSVVGA
GVGSGVGGGLGVGEVRVAVRAAGVNFRDVLIGLGVYPGEALLGSEGAGVVVGVGEGVVNV
GVGDRVMGLFLGGFGPEVVVDARMVVRLPVGWSFVEGATVPVVFLTAWYGLVDLAGVRAG
ERLLVHAAAGGVGMAAVQLARHWGVEVFGTASEGKWEVLRGLGLDDAHIASSRDLGFVEK
FGREHSDGVSEGRSGGVDVVLNSLVGEFVDGSLGLLGEGGRFVEMGKLDVRDAGVVGELW
SGVWYRNFDLVEAGLDRIQEMLCELVGLFDVGVLEALPVRCWDVREVVDALRFVQQARHV
GKVVLRVPGGWGSGTVVVSGGTGVLGRAVVRYLVGCGVGRLLLLSRSGAAGEGVGELIGE
LEGLGVVVDVVACDVGDREALAGVLGGVSGEFPVTGVVHLAGVLDDGMVESLSEGQVRRV
FAGKVDGLVNLDVLTRGMPVEGFVVFSSAAGVFGNAGQGNYAAANACVDAVVARRRVEGL
PGVSLAWGLWSEASGMTGHLDAGDHGRMSRGGAGGLSTGEGVALLDAALGLPQSLLVPIR
LDGRQLQARADVGDVHPLLRGLVRSRSRRAASAVGIGVGGLGGRLVGLVEGERRRVVLDL
VRSHAATVLGHGDVAGVGAGRAFRELGFDSLTAVELRNRLNTATGVRLPATLVFDYPTPT
ELADYLLVQMVGESGAADSDQASSVVVVSEEPLAVVGMACRFPGGVGSPDELWDFVLAGG
DGISGLPVDRGWDVAGLFDPDPEREGTSYTREGGFLHDAAEFDPGFFGISPREALAMDPQ
QRLLLETSWEAVENAGIDPLSLKGTSTGVFAGVTYHDYASRLRSIPQGLEGLLGTGASAS
VVSGRLAYVLGLEGPALSVDTACSSSLVALHLAGQALRQGECSMALAGGVTVMATPGTFV
DFSRQRGLAEDGRCKAFDVSADGFGPAEGVGMLVLERLSDAQRLGHPVLAVIRGSAVNQD
GASNGLTAPNGPSQQRVIRQALASAGLSTMDIDAVEAHGTGTALGDPIEAQALLATYGQG
RPEDQPLRLGSIKSNIGHTQAAAGVAGVIKMVLAMQHGVLPPTLHVNEPTPHVDWASGAV
ELLTEATAWPEVDRPWRAAVSSFGISGTNAHTIIEQAPQKEAEAPESTVKGDALVPWVVS
GRGADALRAQAARLREWVLEHPEHSSADIGHSLVTSRSSFENRAVVLGADRAGLLAGLEA
AAQGEPRSYLIQSPPNGRASGGGVAFLFTGQGAQRVGMGRELAARFPVFASALDEACVQL
DAHLERPLREVLFAEPGTEAAALLDETAFTQAALFAIEVALYRLVESWSLTPDYLLGHSI
GGLAAAHVSGVLSLEDAAEVVAARGRLMQALPKGGAMVSLQASEDELVESLQLLVDDKER
VSVAAVNGPDTVVISGDDEMVTEVAGYWLVQDRKVKRLKVSHAFHSVLMEPMLAEFEQVL
SRVTLNPPRIPVISDSTGLPLTAEQATSPAYWTAHVRNPVLFHQAITHLTEQSVSAFLEL
GPDGVLSAMTRTSLADDSDTTVVPLLRRDRDESEAALTALAELYVNGVAVDWTVLLDGAR
PVALPTYAFQRQRFWLEAGTDPVRQGAFEMESRFWEVVEQGDAAELASAFAAMGLDASAE
EWEPVLPALTSWRQAQQTRSAVDSWRYRIIWKPRTGTPLSSTLTGTWLVAVPTGPEHKEL
VDQCAEALERHGARVVLVRPDASAPADRRTWLAALRQALPEQPHQNLTQTQTQAQEAADA
GQSLAGVVSLVGDVAGTLGLVQGLGGVGVVAPLWCVTRGAVGVGGGDVVVSPVQGLVWGL
GRVVGLEHPERWGGVVDLPVSVDGRGWERFCSVLAGGGGEDQVAVRSSGVFVRRLVPAPA
PAPAPAAVSVGEGGWSPGGGTVLVTGGTGVMGARAARWLAARGAQRLLLVSRAGETAPGV
SELVAELTAMGSRAEVVACDVADRDALAALLAAVPEEYPLTAVVHTAQVQDDGALAEFSS
ERLEPALRAKCSGAWNLHELTTDLSLSAFVLFSSGAGVWGGGGQGAYAAGNAYLDALAEY
RRGLGLPATAIAWGLLEQDTPPGGATAPDPRTDTSDGSDSGTGTDSDSGSGTGTGTGTDS
GSGSGIGGTRMDRRGLAAMDPQAAFDALHDVLSHGETALTVADVDWERFYPAFAVARPRP
LLHDIPAVAALLAEDRDSDGDVQARSDLAERLTALPAEEQQRAVLDLVRTHVAAVLGHSA
PDGVQAGRTFRDLGFDSLTAVELRNRLSSATGVALPATLIFDYPNPSAIADHLRRQLCGG
ENTLASTLTSVSDLEQEAEKAVARFKEDPDQVDLEEITPVISRLKAVLAQYESLRAPSTG
TSSASSDLSSATATELIDIINQEFGSVSE
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGGAGTCCAAGGAGCTGATCGAGGCGCTGCGGGATTCGCTCAAGGAGATTCAGACTCTC
AAGGATGAGAAGGCTGAAATCCTGGAGAAGCAGGGGGAGCCGCTTGCGGTCATCGGCATG
GCCTGCCGTTTCCCCGGCGGAGTGTCGTCCCCGGAGCAGTTGTGGAATCTGGTGGTGAGC
GGTGGGGAAGGCATATCCGGCTTCCCCACGAACCGTGGCTGGGACACCGGGAACCTGTAC
GACCCGGAGACGCAGCGACAAGGGACCTCGTACACCCAGGAAGGCGGTTTCCTGCACGAC
GCCGGTCAGTTCGACCCCGGCTTCTTCGGTATATCGCCGCGCGAGGCCCTGGCGATCGAT
CCCCAGCAGCGTCTCCTCCTGGAGACTTCGTGGGAGGCGATAGAGAGCGCCGGGATCGAC
CCCATGTCACTGCGGGGCAGCGCCACGGGTGTGTTCACGGGACTGAGCTATCACGACTAC
CTCTCTCAGATCGGTTCGGTGCCGGACGAGCTGGAGGGTTATCTCGGGACCGGGAACGCG
GGGAGTGTGGCGTCCGGCCGGGTGGCGTATGTGTTGGGGACTGAGGGTCCGGCGGTGACG
GTGGACACGGCGTGTTCGTCGTCGCTGGTCGCGCTGCATCTTGCTGCCCATGCCCTGCGT
CAGGGCGAGTGCTCGATGGCCCTCGCAGGTGGCGTCACCGTGATGGCGACCCCGGGCGCC
TTTGTGGACTTCAGCCGTCAGCGCGGCCTTGCCGAGGACGGCCGGTGCAAGGCGTTCTCG
GCGGCAGCGGACGGTACTGCCTGGGCCGAGGGTGTCGGAACGCTCCTTGTGGAGCGGCTC
TCGGACGCCCAGCGGCTCGGTCACCCCATCCTTGCGGTGGTTCGTTCCAGCGCGGTGAAT
CAGGATGGTGCGAGTAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATC
CGTCAGGCGCTGGCGGCCGCGGATCTGTCGACTGCTGATGTGGATGTGGTGGAGGCGCAC
GGCACCGGCACCACCCTGGGTGACCCGATCGAGGCGCAGGCGCTGCTGGCGACCTATGGG
CAGGGCCGGCCGGAGGGTCGTCCCATCCGGTTGGGTTCGTTGAAGTCGAACATTGGCCAT
ACGCAGGCCGCTGCGGGTGTGGCGGGTGTGATCAAGATGGTGTTGGCGCTGCGGCACGGT
GTGCTCCCGGCGACGCTGCATGTCGATGAGCCGTCGCCACATGTCGACTGGGCGAGCGGT
GCGGTCGAGCTGCTGACCGAGGCCACCCCGTGGCCCGAGACGGGCCGGCCCAGGCGGGCC
GCGGTGTCGTCGTTCGGCGTGAGCGGTACGAACGCGCATGTGATTCTGGAGCAGGCGCTG
GACGACGGTGACACCGAGGTGTCCACGACTGACGATGAGTCCCTGGTGCCGTGGGTGCTG
TCGGGCCGTGGTGCCGACGGTGTCCGGGCGCAGGCGGCGCGGTTGCGGGAGTGGCTGTTG
GAGCGGCCTGAGGACCGTCCGGTGGATGTGGGTTTCTCGTTGTTGTCGTCGCGGTCGGTG
TTTGAGGACCGGTTGGTGGTGCTGGGTTCCCAGCGTGAGGCGCTGCTTGACGGGTTGGCG
GCGGCTGCTGAGGGGGCGCCGTGGCCGGGGTTGGTTCAGTCGTCTGGGGATGTGTCGTTG
AACCGGGCGGTGTTTGTGTTCCCGGGTCAGGGGTCGCAGTGGGTGGGGATGGGACGTGAG
TTGTACGCCTCTTCGCCTGTGTTCCGGGGGCGGTTGGATGAGTGCGCGGCTGCGTTGGAC
CCGTTGGTGGACTGGTCGCTGATCGATGTTGTACGGGGTGAGTCCGGGGCTCCTGGTCTG
GAACGGGTGGATGTGGTCCAGCCCGTTCTCTGGGCCGTGATGGTGTCCCTGGCGGCTGTC
TGGGAGTCGTGGGGTGTTGTTCCGGCTGCTGTGGTGGGTCATTCGCAGGGGGAGATTGCC
GCCGCGTGTGTGGCGGGAGCGTTGTCGGTGGAGGACGCTGCGCAGGTTGTGGCGTTGCGG
AGCCGTGCGGTACGGGCGATGGCGGGTGACGGAGCCATGGTGTCCGTCGCACTTCCCGCC
GCCGAGGCCGAGGCGTTGACCGGGGACGGTGTGTCCCTGGCCGCTGTCAATGGGCCGTCG
TCCGTGGTGTTGTCGGGAGACCGGTCCGCCCTCACCCCGGTGGTGGAGCGACTCAGCGCT
GAAGGTGTGCGGACGAAGTGGGTGCCGGTGGACTATGCGTCCCACTCCGCCCATATGGAA
CGTATCCGCGAGGAATTGGCGTCCCTGCTGTCCGGGATCGAGCCCAGGACCTCCCGTATC
CCGCTGTACTCCACGGTGAGCGCTGCTCGTATCGACACGTCGCGGATGGACGCCTCGTAC
TGGTTCGACAACATCCGGGGCACGGTCCGCTTCCACGAGACCGTCCAGGCCCTGATCGCC
GACGGACTGACCGCCTTCGTGGAGATATCCCCTCACCCCGTCCTGGCGATGAGCGTTCAG
GACACCCTCGACCAGGCCGAAGCCACCGGTCTCTCCATCGGAACTCTCCGCCGTGACGAG
AACGAACACGAAGCCTTCCTCACCGCCGCCGCCCAACTCTTCGTCGCCGGCCTCCCCATC
GACTGGAACACGGCCGCCTTCACCGACCTCGACACGCGCCGGGTCGACCTCCCCACCTAC
GCCTTCCAGCGTGACTGGTTCTGGCTGTCCGGGCGGGCGGGGGCAGTGGGCGACGTGGGT
TCACTGGGCCTGGGGGCCGTCGGACATCCGCTGCTGGGGGCGGCTGTTTCGGTGGCCGAG
GGGGATGTGGTCGTGCTGACCGGCCGGGTGTCCCTCGGTTCTCATCCGTGGCTGGCTGAT
CATGTGGTGCTGGGTTCGGTGCTGCTGCCGGGGACGGCATTTGTGGAGTTGGCTGTACGC
GCCGGTGACCAGGTTGGCTGCGGCCGAGTGGAAGAGCTGGTGCTGCACGCTCCGCTGGTG
CTCACCGGCGACGAGGCGGTGGACGTCCAGGTGGTGGTCGGTGCCGAGGAGTCGGGGTTC
CGCTCCGTGGACATCTACTCCCGCCCGCACAGCGAGAGCGGCTGGCAGGACCAGGACGCC
TGGACCCATCACGCTGTCGGCACGGTGACGGCCGGAACGGAAGACCCGGCCGACGCTGAT
CTGTCGGTGTGGCCGCCCCGAGACGCGACCCCGGTGGTGATCGAAGACTTTTACGCACAG
CTCGACGCGAGTGGCTACGGGTACGGTCCGGCGTTTCGGGGGTTGCGGGCTGCCTGGCGC
CGGGGCGACGAGGTGTTCGCCGAGGTGGAGCTGCCGGAGAGCGAGCGGGACACAGCCGCC
GAGTTCGGCCTCCACCCTGCCCTTTTTGACGCCGCGCTGCACGGCACGGGGCTCATGGGC
AGCCGGGAGAAGGGCATGTTGCCGTTCTCCTGGAACGGTGTGTCATTGCATGCGAGCGGT
GCATCGGTGCTCCGGGTGCGACTGCGGTCGGCGGCCGATGACGCGATCGAGGTACTGGCA
ACTGATGTGACCGGTGCGCCGGTGCTCTCGGTGGGGTCGCTGGTGCTGCGCTCGGTTACC
GCCGATCAGGTCCGGGCCAACGAGCAGCGCGACTTGTACGAAGTCCAATGGGGTCCGTTT
GCTGGTCCGGTTGGGGTGAGTGGTCGGGATGTGGGTGAGTGGGCGGTGCTTGATCTTCCC
GAGTTGGGTGGGGGTGTTGGGGCGGTTGTTGAGGGTTTGGTGGCTTGTGATGTTGCGGTG
AGGGTTGTGGGTCGGGAGAGCTTTGCGGGGGGTGGGTCTTTGCCGGAGACGTTGATTGTG
CCGGTTGTTGGTGGGGGTGGGGATGCGGTGGATGTGGTGTGTGGTGTGTTGGGTGTGGTG
CGGGAGTGGTTGGGGTTGGTTGGTGGTGTGTCGCGGTTGGTGGTGGTGACGTGGGGTGCT
GTGTCGGTGGGTTCGGGTGAGGGTGTGGGGGATGTGGGTGGTGCTGGGGTGTGGGGTTTG
TTGCGGAGTGCGCAGTCGGAGCATCCGGGTCGGTTTGTGTTGGTGGATGTGGAGGGTGTT
GAGGGTGTGGGGTGGGGTGGGTTGGTTGATGGTGTGGTGTGTGGTGAGGGTCAGGTTGTG
GTGCGGGGTGGTGGGTTGTTGGTGCCGCGGTTGGTGCGGGCTGGTGGTGGTGGGTTGGTG
ATTCCGGAGACATTCACGGGTGGGGCTGAGGTTGTGGGTGGGGTGGGGTCTGGTTGGTGT
GTGGGTGTGGGGGTGGGTTCTGGTGTGGGGACGTTGGAGGGGTTGAGTGTGGTGGGTGCG
GGTGTTGGTTCGGGTGTGGGTGGTGGGTTGGGTGTGGGTGAGGTGCGGGTTGCGGTGCGT
GCTGCGGGGGTGAATTTTCGTGATGTGTTGATTGGTTTGGGTGTGTATCCGGGGGAGGCG
TTGTTGGGGAGTGAGGGTGCGGGTGTGGTGGTGGGTGTGGGTGAGGGTGTGGTGAATGTG
GGGGTGGGTGATCGGGTGATGGGTTTGTTTTTGGGTGGGTTTGGTCCGGAGGTGGTGGTG
GATGCGCGGATGGTGGTGCGGTTGCCGGTGGGGTGGTCGTTTGTGGAGGGTGCGACGGTG
CCGGTGGTGTTTTTGACGGCGTGGTACGGGTTGGTGGATTTGGCGGGGGTGCGTGCGGGG
GAGCGGTTGTTGGTGCATGCGGCGGCTGGTGGTGTGGGGATGGCGGCGGTGCAGTTGGCG
CGGCATTGGGGTGTGGAGGTGTTCGGGACGGCGAGTGAGGGCAAGTGGGAGGTTCTTCGG
GGGCTGGGGTTGGACGACGCGCATATCGCATCTTCTCGGGACCTTGGCTTTGTGGAGAAA
TTCGGGCGTGAACATTCCGATGGTGTTTCTGAGGGTCGGTCTGGTGGTGTGGATGTGGTG
TTGAATTCGTTGGTGGGTGAGTTTGTGGATGGGTCGTTGGGGTTGTTGGGTGAGGGGGGT
CGGTTTGTTGAGATGGGGAAGTTGGATGTGCGGGATGCGGGTGTGGTGGGGGAGTTGTGG
TCGGGTGTTTGGTATCGGAATTTTGATTTGGTGGAGGCGGGTTTGGATCGTATTCAGGAG
ATGTTGTGTGAGTTGGTGGGGTTGTTTGATGTGGGTGTGTTGGAGGCGTTGCCGGTGCGG
TGTTGGGATGTGCGGGAGGTGGTGGATGCGTTGAGGTTTGTGCAGCAGGCGCGTCATGTG
GGGAAGGTGGTGTTGCGGGTTCCTGGTGGTTGGGGTTCGGGGACGGTGGTGGTGTCGGGT
GGTACGGGTGTGTTGGGGCGTGCGGTGGTGCGGTATTTGGTGGGGTGTGGTGTGGGGCGG
TTGTTGTTGTTGAGTCGTTCGGGTGCTGCGGGTGAGGGCGTTGGGGAGTTGATAGGTGAG
TTGGAGGGGTTGGGTGTGGTGGTGGATGTGGTGGCGTGTGATGTGGGTGATCGTGAGGCG
TTGGCGGGGGTTTTGGGTGGGGTGTCGGGGGAGTTTCCGGTGACGGGTGTGGTGCATTTG
GCGGGTGTGTTGGATGACGGGATGGTGGAGTCGTTGTCGGAGGGTCAGGTGCGGCGGGTG
TTTGCGGGGAAGGTGGATGGGTTGGTGAATTTGGATGTGTTGACGCGGGGGATGCCGGTT
GAGGGGTTTGTGGTGTTCTCGTCGGCGGCTGGTGTGTTTGGTAATGCGGGGCAGGGGAAT
TATGCGGCGGCTAATGCGTGTGTGGATGCGGTGGTGGCGCGGCGACGGGTTGAGGGTTTG
CCGGGGGTGTCGTTGGCGTGGGGGTTGTGGTCGGAGGCGAGTGGGATGACCGGGCACCTT
GACGCGGGGGATCACGGTCGGATGAGTCGTGGTGGTGCGGGTGGTTTGTCGACGGGTGAG
GGTGTGGCGTTGTTGGATGCGGCGTTGGGGTTGCCGCAGTCGTTGTTGGTGCCGATTCGT
CTTGATGGTCGGCAGTTGCAGGCGCGGGCGGATGTGGGGGATGTGCATCCGTTGTTGCGG
GGGTTGGTGCGTTCTCGGTCGCGTCGGGCGGCGAGTGCCGTGGGTATTGGTGTGGGTGGT
TTGGGTGGTCGGTTGGTTGGTTTGGTGGAGGGTGAGCGGCGTCGGGTGGTTTTGGATTTG
GTGCGGTCTCATGCGGCGACGGTGTTGGGGCATGGGGATGTGGCGGGTGTGGGTGCGGGG
CGGGCTTTTCGTGAGTTGGGGTTTGATTCGTTGACGGCGGTTGAGTTGCGGAATCGGTTG
AATACGGCGACGGGGGTGCGGTTGCCGGCGACGTTGGTGTTCGATTATCCGACCCCGACT
GAGCTGGCGGACTATTTGTTGGTTCAGATGGTTGGTGAGTCGGGTGCGGCCGACTCCGAC
CAGGCGTCATCAGTAGTGGTGGTGTCGGAGGAGCCGTTGGCTGTGGTGGGTATGGCGTGT
CGGTTCCCTGGTGGGGTGGGTTCGCCGGATGAGTTGTGGGACTTTGTGTTGGCTGGTGGG
GATGGGATTTCGGGTTTGCCGGTGGATCGGGGTTGGGATGTGGCGGGGTTGTTCGATCCG
GATCCGGAGCGTGAGGGGACTTCGTATACGCGTGAGGGTGGTTTCCTTCATGATGCGGCG
GAGTTCGATCCTGGTTTCTTCGGGATATCGCCGCGTGAGGCGTTGGCGATGGATCCGCAG
CAGCGGCTTCTCCTGGAAACATCGTGGGAGGCGGTTGAGAACGCGGGTATCGATCCGTTG
AGTTTGAAGGGGACCAGTACCGGAGTCTTCGCAGGAGTCACCTACCACGACTATGCCTCT
CGGCTGCGTTCCATTCCTCAAGGACTTGAGGGCCTGCTCGGCACAGGGGCCTCCGCCAGC
GTGGTGTCAGGTCGGCTCGCATATGTCCTCGGTCTGGAAGGCCCTGCCCTCAGCGTGGAT
ACGGCGTGTTCGTCGTCGCTGGTCGCGTTGCATCTGGCGGGACAGGCCCTGCGTCAGGGC
GAGTGCTCGATGGCACTCGCCGGCGGTGTGACCGTGATGGCGACCCCGGGGACGTTTGTC
GACTTCAGTCGTCAGCGGGGTCTCGCCGAAGATGGTCGGTGCAAGGCGTTCGATGTCTCC
GCCGATGGGTTCGGGCCGGCCGAGGGCGTGGGCATGTTGGTCCTGGAGCGGCTGTCGGAC
GCGCAGCGCCTGGGCCACCCCGTCCTCGCTGTTATCCGGGGCAGTGCGGTGAATCAGGAT
GGTGCGAGTAATGGGTTGACGGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATCCGCCAG
GCCCTGGCCTCGGCCGGTCTCTCGACCATGGACATCGACGCGGTGGAGGCGCACGGCACC
GGCACGGCGTTGGGCGATCCGATCGAGGCTCAGGCACTCCTGGCGACCTATGGTCAGGGC
CGTCCCGAGGACCAGCCACTGAGGCTGGGTTCGATCAAGTCGAACATCGGACACACCCAG
GCGGCTGCCGGTGTGGCGGGTGTCATCAAGATGGTGCTCGCCATGCAGCACGGCGTCCTC
CCGCCCACACTGCATGTCAACGAACCGACCCCGCATGTGGATTGGGCGAGCGGCGCGGTT
GAGCTGTTGACCGAGGCCACCGCCTGGCCCGAGGTGGACCGCCCGTGGCGCGCGGCAGTT
TCCTCCTTCGGCATCAGCGGCACCAACGCCCACACGATCATCGAACAGGCCCCCCAGAAG
GAGGCCGAGGCTCCCGAGTCGACCGTGAAGGGCGATGCCCTCGTGCCGTGGGTGGTGTCA
GGCCGTGGCGCCGACGCCCTGCGGGCGCAGGCCGCCCGGCTGCGGGAGTGGGTGCTTGAA
CACCCTGAACACAGCTCGGCCGATATCGGTCACTCACTGGTCACCTCCAGGTCGTCGTTC
GAAAACCGGGCCGTCGTGCTGGGTGCCGACCGGGCGGGCCTGCTGGCTGGGCTGGAAGCA
GCGGCCCAGGGCGAGCCCCGGTCCTATCTGATCCAGTCGCCCCCCAATGGTCGAGCCTCC
GGTGGTGGTGTGGCGTTCCTGTTCACCGGGCAGGGCGCACAGCGCGTCGGCATGGGCCGT
GAACTCGCCGCACGTTTCCCGGTGTTCGCGTCCGCGCTGGACGAGGCCTGTGTTCAGCTC
GACGCGCATCTGGAGCGTCCGTTGCGTGAGGTGCTGTTCGCGGAGCCCGGCACTGAGGCT
GCGGCGCTGCTGGACGAGACGGCGTTCACGCAGGCAGCCCTGTTTGCCATTGAGGTTGCG
CTGTATCGGTTGGTGGAGTCGTGGTCGCTGACGCCGGACTACCTTCTGGGCCACTCCATC
GGTGGTCTGGCCGCGGCGCATGTGTCGGGTGTGCTGTCGCTGGAGGACGCGGCCGAGGTC
GTCGCGGCTCGGGGTCGGTTGATGCAGGCCCTGCCCAAGGGCGGAGCCATGGTCTCCCTC
CAGGCGTCGGAAGACGAACTGGTGGAATCACTGCAACTTCTTGTCGACGACAAGGAGCGG
GTCTCGGTCGCGGCGGTGAACGGCCCGGACACGGTGGTGATCTCCGGTGACGACGAGATG
GTGACTGAGGTCGCCGGGTACTGGCTGGTGCAGGACCGGAAGGTGAAGCGGCTGAAGGTC
AGTCATGCTTTCCACTCGGTGTTGATGGAGCCGATGCTCGCCGAGTTTGAGCAGGTCCTG
TCTCGGGTCACGCTGAACCCGCCGCGGATCCCGGTCATCTCCGACTCCACCGGTCTGCCT
CTCACGGCGGAGCAGGCCACCTCTCCCGCGTACTGGACCGCCCACGTCCGTAACCCGGTC
CTGTTCCACCAGGCCATCACCCACCTCACAGAGCAGAGTGTGAGTGCCTTCCTGGAGCTG
GGCCCCGACGGTGTGCTCAGCGCCATGACCCGCACGAGCCTGGCCGACGACAGTGACACC
ACGGTCGTCCCCCTGCTGCGGCGGGACCGGGATGAGTCCGAGGCGGCGTTGACTGCGCTG
GCCGAGCTGTATGTCAACGGTGTGGCGGTCGACTGGACCGTACTTCTCGACGGCGCCCGT
CCGGTCGCCCTGCCGACCTACGCCTTCCAGCGCCAGCGTTTCTGGCTGGAGGCAGGCACC
GACCCCGTGCGTCAGGGCGCCTTCGAGATGGAGAGCCGCTTCTGGGAGGTCGTGGAGCAG
GGCGACGCGGCCGAGCTGGCCAGTGCCTTCGCCGCGATGGGTCTGGACGCGTCCGCCGAG
GAATGGGAACCGGTGCTGCCCGCGCTGACCTCTTGGCGGCAGGCGCAGCAGACGCGGTCG
GCGGTGGACTCCTGGCGCTACCGCATCATCTGGAAGCCGCGCACCGGCACGCCGCTGTCC
AGCACCCTGACGGGAACCTGGCTGGTGGCCGTGCCCACGGGCCCGGAGCACAAGGAACTC
GTCGATCAGTGCGCGGAAGCCCTGGAACGCCACGGCGCGCGTGTCGTCCTCGTACGCCCG
GACGCGTCGGCCCCCGCCGACCGCCGAACCTGGCTCGCGGCGCTGCGACAGGCCCTCCCG
GAACAACCGCATCAGAATCTGACCCAGACCCAGACCCAGGCTCAGGAAGCGGCAGACGCC
GGTCAGTCCCTCGCCGGGGTTGTGTCTCTGGTGGGGGATGTGGCGGGGACGTTGGGGTTG
GTGCAGGGGTTGGGTGGTGTGGGTGTGGTGGCTCCGTTGTGGTGTGTGACGCGGGGTGCT
GTGGGTGTGGGTGGTGGGGATGTGGTGGTGTCTCCGGTGCAGGGTTTGGTGTGGGGGTTG
GGTCGGGTGGTGGGTTTGGAGCATCCGGAGCGGTGGGGTGGTGTGGTTGATCTGCCGGTG
TCGGTGGATGGTCGGGGTTGGGAGCGTTTCTGTTCGGTGTTGGCGGGTGGTGGTGGTGAG
GATCAGGTGGCGGTGCGGTCGTCGGGTGTGTTCGTACGACGTCTGGTTCCGGCTCCCGCT
CCCGCCCCGGCCCCGGCTGCGGTCTCGGTTGGGGAGGGTGGGTGGTCGCCGGGTGGGGGG
ACGGTCCTTGTCACGGGTGGTACGGGGGTGATGGGGGCTCGGGCCGCGCGTTGGTTGGCG
GCTCGGGGTGCCCAGCGTCTGTTGTTGGTGAGCCGTGCGGGGGAGACCGCTCCGGGTGTG
TCGGAGTTGGTGGCGGAGCTGACCGCGATGGGCAGCCGGGCCGAGGTCGTCGCTTGTGAT
GTCGCCGACCGTGACGCACTGGCCGCGCTCCTCGCCGCCGTACCGGAGGAGTATCCACTG
ACCGCGGTCGTCCACACCGCCCAGGTCCAGGACGACGGCGCGCTGGCGGAGTTCAGCTCC
GAGCGGTTGGAACCGGCGCTGCGGGCCAAGTGCTCGGGTGCCTGGAACCTCCATGAACTC
ACCACGGACCTGTCCCTGTCGGCGTTCGTCCTCTTCTCCTCCGGCGCAGGTGTCTGGGGC
GGCGGCGGACAGGGCGCGTACGCGGCGGGCAACGCCTACCTCGACGCGCTGGCCGAGTAC
CGCCGGGGGCTCGGGCTGCCCGCGACGGCGATCGCCTGGGGCCTGCTGGAGCAGGACACC
CCGCCAGGCGGCGCCACGGCACCCGACCCCCGTACCGACACGAGCGACGGCAGCGACTCC
GGCACGGGCACCGACAGCGACTCCGGCTCCGGCACCGGCACCGGCACGGGCACCGACAGT
GGCTCCGGCTCTGGCATCGGCGGTACCCGGATGGACCGCCGCGGACTGGCCGCCATGGAC
CCGCAGGCCGCGTTCGACGCGCTGCACGACGTCCTCAGCCACGGCGAGACCGCGCTGACG
GTGGCCGATGTCGACTGGGAGCGGTTCTACCCGGCCTTCGCCGTGGCCCGCCCCCGACCG
CTACTGCACGACATCCCGGCCGTCGCCGCACTGCTCGCCGAGGACCGCGACAGCGACGGC
GACGTACAGGCCCGTTCGGACCTCGCCGAACGCCTCACAGCACTCCCTGCGGAGGAACAG
CAGCGGGCCGTACTCGATCTGGTGCGCACGCATGTCGCGGCGGTGCTGGGACACAGCGCC
CCCGACGGCGTACAGGCCGGACGGACCTTCCGCGACCTCGGCTTCGACTCGCTGACCGCA
GTGGAACTGCGCAACCGGCTCAGCTCCGCGACCGGAGTCGCCCTGCCCGCCACATTGATC
TTCGACTATCCCAACCCCAGCGCGATCGCCGACCATCTGCGGCGGCAACTGTGCGGTGGG
GAGAACACCTTGGCGTCCACCCTGACCTCCGTCTCCGACCTGGAGCAGGAGGCGGAGAAA
GCGGTGGCCCGGTTCAAGGAGGATCCGGACCAGGTGGATCTCGAAGAGATCACTCCGGTG
ATCTCACGGCTGAAAGCTGTCCTCGCGCAGTACGAATCTCTGCGCGCTCCGTCGACTGGT
ACATCGTCTGCGAGTAGTGACCTCAGTTCGGCGACCGCTACTGAACTGATCGACATCATC
AACCAAGAATTCGGAAGCGTTTCCGAGTAG
[13] KS33..409
[13] AT564..878
[13] methylmalonyl-CoA752..756
[13] DH929..1095
[13] ER1430..1745
[13] KR1754..1933
[13] ACP2037..2107
[14] KS2131..2506
[14] AT2666..2990
[14] malonyl-CoA2862..2866
[14] kr3320..3499
[14] ACP3644..3714
[13] KS97..1227
[13] AT1690..2634
[13] methylmalonyl-CoA2254..2268
[13] DH2785..3285
[13] ER4288..5235
[13] KR5260..5799
[13] ACP6109..6321
[14] KS6391..7518
[14] AT7996..8970
[14] malonyl-CoA8584..8598
[14] kr9958..10497
[14] ACP10930..11142

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-687]  G3DSA:3.40.366.10 [752-869]  G3DSA:3.40.366.10 [2659-2791]  G3DSA:3.40.366.10 [2862-2979]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1560-1581]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2065-2080]  PS00012 [3672-3687]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2030-2147]  2.19999900980708e-28 SSF47336 [3635-3721]  2.10000267834031e-24 SSF47336
SSF47336   ACP_like
 [2037-2107]  PS50075 [3644-3714]  PS50075
PS50075   ACP_DOMAIN
 [2035-2107]  2.70000000000002e-48 G3DSA:1.10.1200.10 [3641-3717]  2.70000000000002e-48 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2040-2106]  4.00000000000001e-12 PF00550 [3647-3713]  3.3e-13 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1450-1578]  7.00000734129907e-27 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1571-1685]  7e-12 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1453-1508]  1.2e-05 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1754-1932]  1.5e-54 PF08659 [3320-3498]  7.89999999999997e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [33-283]  3.10000000000005e-94 PF00109 [2131-2381]  1.20000000000001e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  1.99999999999999e-47 PF02801 [2389-2506]  2.1e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-878]  5.50000000000008e-108 PF00698 [2666-2990]  1.9e-63 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-861]  1.09999184471405e-72 SSF52151 [2663-2973]  4.80002938964645e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [689-751]  1.20000117458134e-16 SSF55048 [2793-2861]  4.70000326671386e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-295]  G3DSA:3.40.47.10 [297-459]  G3DSA:3.40.47.10 [2134-2393]  G3DSA:3.40.47.10 [2394-2561]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-407]  1.09999184471405e-99 SSF53901 [2123-2505]  8.19994104549874e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1523-1709]  4.30000000000003e-42 G3DSA:3.40.50.720 [1754-1939]  1.09999999999999e-60 G3DSA:3.40.50.720 [3319-3500]  9.69999999999989e-60 G3DSA:3.40.50.720 [3553-3574]  9.69999999999989e-60 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [2294-2310]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-860]  2.0000139277205e-128 SM00827 [2667-2970]  1.3000049540733e-113 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2038-2110]  2.99998750445706e-35 SM00823 [3645-3717]  2.69998997787809e-37 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [929-1095]  2.80000504261099e-85 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [35-461]  SM00825 [2133-2559]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1754-1933]  2.39999798157265e-44 SM00822 [3320-3499]  8.30001403791594e-49 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1430-1745]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit