close all open/close all

CDS information : Halsto_00060


close this sectionLocation

Organism
StrainHC34
Entry nameHalstoctacosanolide
Contig
Start / Stop / Direction78,095 / 93,793 / + [in whole cluster]
78,095 / 93,793 / + [in contig]
Location78095..93793 [in whole cluster]
78095..93793 [in contig]
TypeCDS
Length15,699 bp (5,232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase
Gene
Gene (GenBank)hlsF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16568718] The complete biosynthetic gene cluster of the 28-membered polyketide macrolactones, halstoctacosanolides, from Streptomyces halstedii HC34. (J Antibiot (Tokyo). , 2006)

close this sectionPKS/NRPS Module

15 methylmalonyl-CoA
16 methylmalonyl-CoA
17 malonyl-CoA
KS34..410
AT571..885
DH936..1115
KR1448..1627
ACP1731..1801
KS1827..2203
AT2359..2672
DH2723..2901
KR3241..3420
ACP3524..3594
KS3616..3992
AT4152..4473
KR4796..4978
ACP5083..5152

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase]
MVNDETLVKYLRQVTADLRESRRQVTEMAERSAEPLAIVGMACRLPGGVSSPDELWRLAL
EGREGISGFPTNRGWDVDGLYDPDPDQQGTSYTCEGGFLHEAGDFDPAFFGISPREALAM
DPQQRLLLETSWEAVESAGIDPQTLKGAGVGVFTGMSYHDYISQIDTVPDGLEGYLGTGN
AGSVVSGRIAYVMGLEGPAVTIDTACSSSLVAMHLAGQALRQGECSMALAGGVTVMATAA
TFVDFSRQRGLAPDGRCKSFAAAADGTGWAEGAGMLLLERLSDAQRLGHPILAVIRSSAV
NQDGASNGLTAPNGPSQQRVIRQALSAVGLSTADVDAVEAHGTGTPLGDPIEAQALLATY
GQGRPEGRPLWLGSIKSNIGHAQAAAGVAGVIKMVMALRHGILPATLNLDEPTPHVDWAS
GAVSLLRETTPWPEVGRPRRAGVSSFGISGTNAHTILEQAPEVSEAETAVPAAPVSGTGG
VLPFVVSGRGTAAALAQAARLSDWIRERPLDGLPDIARSLVTSRPAFEDRLVVVAADRES
LLTGLAAAGRGEPHPGVISPTTSETPGDRAVFVFPGQGSQWVGMGRELYASSPVFRARLD
ECARALDPLVDWSLIDVVRGESGAPGLERVDVVQPVLWAVMVSLAAVWESWGVTPAAVVG
HSQGEIAAACVAGALSVEDAAQVVALRSRAVRAMAGDGAMVSVALPAAEAEALTGDGVSL
AAVNGPSSVVLSGDRSALTPVVERLSAEGVRTKWVPVDYASHSAHMERIREELASLLSGI
EPKTSRIPLYSTVSAQVIDTSVMDAGYWFDNIRGTVRFHETVQALITDGLTAFVEISPHP
VLAMSVQDTLDQAEATGLSIGTLRRDENEHETFLTAAAQLFVAGLSIDWHTAAFTDLDTR
RVDLPTYAFQRERFWLQSAAGTIGDAAGLGQGVTGHPLLGAVVAVADRDVAVLTGRVSLR
THPWLADHAVLGTVILPGTAHVELAIRAGDQVGAARLEELVIHSPLLLTDAADETGQTGQ
MGDGVDLQVVVGAADGSGYRSIDIHSRPHTDADWSQDDWTHHASGVLTSASGRPAEPSDE
LAAWPPQGANPVDLDGIYERLAGAGFGYGPVFQGLRAAWRSGQDVYAEVELTAGDTTDPA
DYGIHPALFDAALHAMSLTSVGDGTQDAEANQGRLPFSWSGVSLHAGGAGTLRVRMRRES
EDTVSLVAADPTGAPVVSVDSLVLRPVTAEQVREQRGARVENMFTLDWFPLDPALAGTAD
RAGAGSWAVLDTLDLSGSAAVRQGLVRQGIGAATGSALAALAEEGPAPESVVLPAVALPE
GAAGARQAACAVLELVQEWLRDSRWDASRLTVVTSGAVAVRPDEDDLPDLAAATVWGLVR
TAQSEHPDRFVLVDADERAIGDGSWLPGALSGEPQTAVRAGDLFLARVHQAHAAAEDGEP
QRAWDPSGTVLVVGGTGVLGALIARHLVDRGVRRLLLTSRRGIEAPGARDLVARLAADGA
MVEVAACDAADPEALAATLADIPREHPLTAVVHTAGVLDDGVIESLTPERFDGVFASKVD
AAWNLHRLTEELPLAAFMMFSSASGTFGNAGQANYSAANAFVDALAQHRRARGLPAVAVG
WGLWAEASGMTGHLDEADRGRISRGGAGALSADQGLALFDAALIAPRAAVLGMRLNTSVL
RAQAASGVLPHLLRDLVRVPVRRAASAEGAGGGGLADRLTGSDPAEQQRLVLELVRTHVA
AVLGHTDAERVGAGKAFRELGFDSLTSVELRNRLNAATGLRLPATLVFDHPTPTAIAELV
REQVLGQATAAPHRPAASPNRPGPSDEPLAVVGMACRFPGGAGSPEELWKLVMAGGDGIT
TFPEDRGWDVQALYDPDPEHQGTSYTCEGGFLHDAGEFDAGFFGISPREALAMDPQQRLL
LEAGWQAVESAGIDPLTLKGSDTGVFAGVMYHDYASRLASVPEGLEGYLGTGNAGSVVSG
RVAYVLGAEGPAVTVDTACSSSLVALHLAGQALRQGECSLALAGGVTVMSTPDAFVDFSR
QRAFAPDARCKAFAAAADGTGWSEGVGVVLIERLSDARRQGHPILAVIRSSAVNQDGASN
GLTAPNGPSQQRVIRQALSTAGLSTSDVDAVEAHGTGTNLGDPIEAQALLATYGQGRPES
LPLRLGSLKSNIGHTQAAAGVAGVIKMVLALQHGVLPATLHVDEPTPHVDWASGAVELLT
EATPWPETGRPRRAAVSSFGISGTNAHVILEQAPDDGGTEVSTTDDDSLVPWVLSGRGAD
GVRAQAARLRAWLLERPGAHPADIGSSLLTSRSLFEDRLVVLGSQREALLDGLAAAAEGA
PWPGLIQSSADASLTRAAFVFPGQGSQWVGMGRELYASSPVFRARLDECARALDPLVDWS
LIDVVRGESGAPGLERVDVVQPVLWAVMVSLAAVWESWGVVPAAVVGHSQGEIAAACVAG
ALSVEDAARVVALRSRALRAMAGDGAMVSVALPAAEAEALTGDGVSLAAVNGPSSVVLSG
DRSALTPVVERLSAEGVRTKWVPVDYASHSAHMERIREELASLLSGIEPKTSRIPLYSTV
SAQVIDTSVMDAGYWFDNIRGTVRFHETVQALITDGLTAFVEISPHPVLAMSVQDTLDQA
EANGLSIGTLRRDENEHEAFLTAAAQLFVAGLPIDWHTAAFTDLDTRRVDLPTYAFQRER
FWLPTGGGAVGDAAGLGLGTVRHPLLGAAVSVAENGTTLLSGRISLRTHPWLADHAVLGS
VLLPGTAFLELAVCAGDQVGCARVEELVIQAPLVLTGDDAADLQVVVGAPDGSGLRAVDI
YSRPHSGAEWADEAWTLHASGSLAASAATFPDTPDGAAVADAAANDLTVWPPQQATPVEI
DGFYELLGGTGFQYGPLFQGLRAAWRSGDDIYAEVGLPEHEHAGTDGFGIHPALFDGALH
GIGLGTATDATTTDTTSDDATATDTTSDGAAAGPRGLLPFSWTGVSLYASGASVLRVRLR
RQGGDAVGLVAADPTGAPVVSVDSLVLRPMTADQVRPGGGARRSHLYALDWTPTGIGAPA
DGSKTWGVLESPVAGVVAEAAAPTARRGPLDALLADGAVPDVVLLAAAGVDSTPAAAAAD
ARDLVGSVLATVQEWLAAPGTEAARLVVLTRGAVAVGLDDDITDLAAASVWGLLRVAQNE
HPDRFVLVDADAAAVASGAVRDAVELDEPQIALRGDTVYVPRVHRAPAGADDGPRDWDVP
GTVLVTGGTGTLGTAVAEHLAAGGARRLLLVSRQGPAAPGARELAARLTAAGTETEVAAC
DVADPAALAGLLATIPTGQPLTAVVHAAGALDDGILESLTPERIASVFAPKADAAWHLHE
LTADLPLTAFVLFSSAAGTFGSAGQGNYAAANAFLDGLAQHRRARGLPAVSLGWGLWAET
SALTGQLSQGDRDRMDRTGAGALSTDEGLALLDTAAGTPRAALLPMRMNTAALHAQANSG
ALPHLLRDLVRVPARRTAAGDAGTGNPLAARLAGRTGPERQRIVLDLVRGHVAAVLGHSD
PKGVGAQRAFRDLGFDSLTAVELRNRLSAATAIRLPATLIFDCPTPAAIADFVLERALGQ
GEHTDRPRTVATTTDEPMAVIGMACRFPGGVASPEDLWRLVAEGRDGISGFPADRGWDLA
NLYHPDPDHEGTTYTREGGFLHEAGRFDPGFFGISPREAVAMDPQQRLLLESSWEAIESA
GIDPLTLRGTDTGVFAGLMYHDYAVQLAAVPEGAEAFLGIGNAGGVASGRVAYVLGTEGP
AVTVDTACSSSLVALHWAAQALRQGDCSLALAGGVTVMATPGAFVDFSRQRGLAADGRCK
SFAAGADGTGWAEGVGMVLLERLSDAQRLGHPVLAVIRSSAVNQDGASNGLTAPHGPSQQ
RVIRQALASAGLSAADVDAVEAHGTGTTLGDPIEAQALLATYGQNRPEDRPLRLGSLKSN
IGHAQAAAGVAGVIKMVMALRHGVLPATLHVDEPTPHVDWASGAVELLAESMPWPETGRP
RRAAVSSFGISGTNAHTILEQAPEIAPVPAVEPATVLPGPVPWVVTGRGPAGLRGQAARL
AEWARTHPEADAADVARSLVTARSAFDERLVVLGADREALIAGVTAVGRGEPWPGAVRSA
PGGLAAGSVGLLFAGQGSQRPGMGRELAAAAPVFAAALDEVCAALDPHLDQPLRDVLFAE
PDTPLAALLDRTGWTQPALFAVEVALFRLLRSWGVTPDFVAGHSIGGLAAAHTAGVLSLA
DAATVVAARGRLMQALPEGGAMASLQATEDEVTAELAAFDGRVSIAAVNGPQAVVVSGDE
DAVDEIAAHWRERGRKAKRLKVSHAFHSSRMEPVLAEFERILASVTLHPPVIPVISDTTG
EPLTDAEATSPRYWAEHIRRPVRFHQVVTTLAAHGADRLVEIGPDGVLSAMAQQSLTGDA
AAGTVVVPLLRTDRDEYEAALTAAATLFVHGTPVDWPALLQPLDGRRVALPTYAFQHERY
WLEARTSAADPVPAHHDADSPFWEAVERGDASVLAETFASAGVRAPAEAWAPVLPALASW
RGTRHGRTTADTWRHRVTWKPRTRTPAAVLTGDWLLIAPVQPEHKELTDHCADALARHGA
TVTLLRPDQLDPDDRSAWRVLLDEAVQRTGTVSGVVSLIGLVEEAHLRHPSVPVGLAATL
ALVQGLGDAGVDAPLWCLTRGAVSTSGTDPLHSPVQALLWGLGRVVGLEHPERWGGLVDL
PEETGTHCWEQLCGILAAADDEDQLAVRPAGVFLRRLTPAPATGSLDRDGSWTPHGTVLI
TGGTGVLGAQLARWAVAAGGRSLLLLSRRGPDAPGAAALRTELEAAGARISIVSCDITDR
AALQRAVATVPDEHPLTTVIHAAGVDVHQYEPAAGLTLDLLAPVVEAKVAGARALEDLIA
DQPQIESFVLFSSGAGIWGGGGQGSYAAGNAFLDALAEHRRGRGLPATAIAWGPWGEDET
GDDNDAARRQMDRRGLPAMSPELALRAFRRILDHDEIALTVADIDWERFYPAFALSRPRP
LLHDVPRVAELLTDSAAPATSGGRPALVEQLLGTPPAEQRHLVLVAVRTEVAAVLGHDPD
GIGANRAFRDLGFDSLTAVELSRRLAPVTGLQLPPTLVFDHPTLADVAADIHQRLTDATA
ELFVTLDRLESRLADSVLDADLGRAAVDRLSLALARLKELVADGDEPNRADTAANIDDAT
DEEIFELLDREL
selected fasta
>polyketide synthase [type I polyketide synthase]
ATGGTTAACGACGAGACACTTGTCAAGTACCTGCGGCAGGTTACTGCCGACCTTCGGGAG
AGTCGCCGCCAGGTGACGGAGATGGCGGAGCGGTCGGCGGAGCCACTGGCGATCGTCGGA
ATGGCCTGCCGTCTCCCCGGAGGAGTGAGTTCGCCGGACGAGCTGTGGCGGCTGGCCCTC
GAAGGCCGGGAAGGGATATCCGGCTTCCCCACCAACCGTGGCTGGGACGTGGACGGGCTC
TACGACCCGGACCCGGACCAGCAGGGCACCTCGTACACCTGCGAGGGCGGCTTCCTCCAC
GAGGCCGGTGACTTCGACCCCGCCTTCTTCGGGATCTCCCCGCGCGAGGCCCTGGCCATG
GACCCGCAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAAGCGGTGGAAAGCGCGGGCATC
GACCCCCAGACCCTCAAGGGCGCCGGCGTCGGTGTGTTCACCGGCATGAGCTACCACGAC
TACATATCCCAGATCGACACCGTGCCCGACGGCCTGGAGGGCTATCTCGGCACCGGTAAC
GCGGGCAGTGTGGTCTCCGGTCGGATCGCCTATGTGATGGGACTCGAAGGCCCGGCGGTG
ACCATCGACACGGCGTGTTCGTCGTCGCTGGTCGCAATGCATCTGGCGGGTCAGGCCCTG
CGCCAGGGCGAGTGCTCGATGGCCCTCGCCGGTGGCGTGACCGTGATGGCGACGGCGGCC
ACGTTCGTGGACTTCAGCCGTCAGCGCGGACTGGCGCCCGACGGGCGTTGCAAGTCCTTC
GCCGCCGCTGCGGACGGCACCGGCTGGGCCGAGGGCGCCGGAATGCTCCTCCTGGAGCGA
CTCTCGGACGCCCAGCGGCTCGGCCACCCCATCCTGGCCGTGATTCGGTCCAGCGCCGTC
AACCAGGACGGCGCCAGCAACGGTCTCACCGCGCCGAACGGTCCGTCGCAGCAGCGGGTC
ATCCGGCAGGCGCTGTCGGCGGTCGGTCTCTCCACCGCCGATGTCGACGCCGTCGAGGCC
CACGGCACGGGTACGCCGTTGGGCGACCCGATCGAGGCGCAGGCCCTGCTGGCCACCTAC
GGACAGGGACGCCCGGAGGGCCGACCGCTCTGGCTCGGCTCGATCAAGTCGAACATCGGT
CATGCGCAGGCCGCCGCCGGTGTCGCCGGTGTGATCAAGATGGTGATGGCGCTCCGCCAC
GGCATCCTTCCCGCGACGCTCAACCTGGACGAGCCGACGCCGCATGTGGACTGGGCGAGC
GGTGCGGTGTCCCTCCTCCGGGAGACGACTCCCTGGCCCGAGGTCGGCAGGCCGCGCCGG
GCAGGTGTGTCCTCGTTCGGAATCAGCGGCACGAACGCGCACACCATCCTGGAACAGGCC
CCGGAGGTGTCCGAGGCTGAGACGGCTGTGCCCGCCGCACCGGTCTCCGGCACCGGCGGC
GTCCTGCCGTTCGTCGTCTCCGGGCGTGGCACGGCGGCTGCGCTGGCCCAGGCCGCGCGG
CTGAGCGACTGGATCCGGGAGCGCCCCTTGGACGGCCTCCCCGATATCGCCCGCTCCCTG
GTCACCTCCCGGCCCGCCTTCGAGGACCGGCTGGTGGTCGTGGCCGCTGACCGTGAGTCC
CTGCTCACCGGCCTGGCCGCAGCCGGACGCGGCGAGCCGCACCCCGGCGTGATCTCCCCC
ACCACCAGCGAGACTCCCGGCGACCGGGCTGTGTTCGTCTTCCCGGGTCAGGGGTCGCAG
TGGGTGGGGATGGGGCGTGAGCTGTACGCGTCGTCTCCCGTCTTCCGGGCGCGGTTGGAC
GAGTGCGCGCGGGCGTTGGATCCGCTGGTGGACTGGTCCCTGATCGATGTTGTACGGGGT
GAGTCCGGGGCTCCTGGTCTGGAGCGGGTGGACGTCGTCCAGCCCGTCCTCTGGGCGGTG
ATGGTGTCCCTGGCGGCTGTCTGGGAGTCATGGGGTGTTACGCCAGCCGCGGTGGTGGGT
CACTCACAGGGTGAGATCGCTGCCGCGTGTGTGGCGGGGGCGTTGTCCGTGGAGGATGCG
GCGCAGGTGGTGGCGTTGCGGAGCCGTGCCGTACGGGCGATGGCGGGCGACGGCGCGATG
GTGTCCGTCGCGCTCCCCGCCGCTGAGGCTGAGGCGCTGACCGGGGACGGCGTGTCCCTG
GCGGCTGTCAACGGTCCGTCGTCTGTGGTCCTGTCGGGGGACCGGTCTGCCCTCACCCCC
GTGGTGGAGCGGCTCAGCGCCGAGGGTGTACGGACGAAGTGGGTGCCGGTGGACTACGCG
TCCCACTCCGCCCATATGGAGCGCATCCGTGAGGAATTGGCGTCCCTGCTGTCCGGGATC
GAGCCCAAGACCTCCCGTATCCCGCTCTACTCCACCGTGTCGGCGCAGGTCATTGACACG
TCGGTCATGGATGCCGGCTACTGGTTCGACAACATCCGGGGCACCGTCCGCTTCCATGAG
ACCGTGCAGGCCCTGATCACCGACGGACTGACCGCCTTCGTGGAGATATCCCCGCACCCC
GTCCTGGCGATGAGCGTTCAGGACACCCTGGACCAGGCCGAAGCCACCGGTCTCTCCATC
GGCACCCTCCGCCGCGACGAGAACGAACACGAGACCTTCCTCACCGCCGCCGCCCAACTC
TTCGTCGCCGGGCTTTCCATCGACTGGCACACGGCGGCGTTCACCGACCTCGATACGCGC
CGGGTCGACCTCCCCACCTACGCCTTCCAGCGCGAGCGCTTCTGGCTCCAGTCCGCAGCG
GGCACCATCGGCGACGCGGCCGGGCTCGGCCAGGGCGTCACGGGACACCCCCTCCTCGGT
GCGGTGGTCGCGGTCGCCGACCGCGATGTGGCCGTACTCACCGGTCGGGTGTCGCTGCGT
ACGCATCCCTGGTTGGCCGATCATGCCGTCCTCGGCACGGTGATTCTGCCCGGTACGGCG
CATGTGGAGCTGGCGATCCGGGCCGGGGACCAGGTGGGCGCCGCCCGGCTGGAGGAGTTG
GTCATCCACAGCCCGCTGCTCCTGACCGATGCGGCGGACGAGACCGGCCAGACGGGTCAG
ATGGGTGACGGAGTCGACCTTCAGGTCGTCGTCGGTGCCGCCGACGGTTCCGGTTACCGC
AGCATCGACATCCACTCCCGCCCGCACACCGACGCCGACTGGAGCCAGGACGACTGGACC
CACCACGCGTCCGGCGTGCTGACCAGCGCGTCAGGCCGGCCCGCCGAGCCCTCCGACGAG
CTGGCGGCCTGGCCGCCACAGGGCGCCAACCCCGTCGACCTGGACGGCATATACGAACGG
CTGGCCGGGGCCGGATTCGGCTACGGCCCCGTCTTCCAGGGCCTGCGCGCCGCCTGGCGC
AGTGGACAGGACGTGTACGCCGAGGTGGAGCTGACCGCCGGGGACACCACCGACCCGGCG
GACTACGGCATCCACCCCGCGCTCTTCGACGCGGCCCTGCACGCGATGAGCCTGACCTCG
GTGGGCGACGGAACCCAGGACGCCGAGGCCAACCAGGGCCGGCTGCCCTTCTCCTGGTCC
GGTGTCTCCCTGCACGCGGGCGGCGCGGGCACGTTGCGGGTACGGATGAGACGCGAGAGC
GAGGACACGGTCAGCCTGGTCGCCGCAGACCCCACCGGCGCGCCGGTCGTCTCGGTCGAC
TCGCTGGTGCTGCGGCCCGTGACGGCGGAGCAGGTCCGAGAGCAGCGCGGTGCCCGGGTC
GAGAACATGTTCACCCTCGACTGGTTCCCGCTCGACCCCGCCCTGGCCGGAACGGCCGAC
CGGGCGGGCGCCGGGAGCTGGGCTGTCCTGGACACCCTGGACCTATCGGGCTCCGCCGCC
GTACGACAGGGACTCGTACGGCAGGGCATCGGCGCCGCGACGGGCTCAGCCCTGGCCGCA
CTCGCCGAGGAAGGACCGGCGCCGGAGAGCGTGGTGCTGCCCGCTGTCGCGCTCCCCGAA
GGGGCCGCCGGTGCGCGGCAGGCCGCCTGCGCGGTGCTGGAGCTGGTGCAGGAGTGGCTG
CGTGACTCCCGCTGGGACGCGTCCCGGCTGACCGTGGTGACCAGCGGCGCGGTCGCCGTC
CGGCCCGACGAGGACGACCTCCCCGATCTGGCGGCGGCGACGGTCTGGGGTCTGGTGCGG
ACCGCGCAGTCCGAGCACCCCGACCGGTTCGTCCTGGTTGACGCCGACGAGCGGGCAATC
GGTGACGGTTCCTGGCTGCCTGGGGCGCTCAGCGGAGAGCCCCAGACGGCGGTACGGGCC
GGTGACCTCTTCCTGGCGCGGGTCCACCAGGCCCACGCCGCCGCGGAGGACGGCGAACCG
CAGCGGGCATGGGACCCCTCCGGCACCGTCCTCGTGGTAGGCGGCACCGGTGTGCTCGGT
GCGCTGATCGCCCGCCATCTGGTGGACCGTGGCGTCCGCAGGCTGCTGCTCACCAGCCGT
CGGGGCATCGAGGCGCCCGGCGCCCGTGATCTGGTGGCCCGGCTGGCGGCTGACGGTGCG
ATGGTGGAGGTCGCCGCGTGCGACGCCGCCGACCCGGAGGCGCTGGCCGCCACGCTGGCG
GACATTCCCCGGGAGCACCCGCTGACCGCCGTCGTCCACACCGCCGGTGTACTGGACGAC
GGAGTGATCGAATCACTCACGCCCGAGCGCTTCGACGGCGTGTTCGCGTCCAAGGTGGAC
GCCGCGTGGAACCTGCACCGGCTCACCGAGGAACTGCCGCTCGCCGCCTTCATGATGTTC
TCCTCGGCCTCCGGCACCTTCGGTAACGCGGGCCAGGCGAACTACTCGGCCGCCAACGCG
TTCGTGGACGCCCTGGCCCAGCACCGGCGGGCCCGTGGCCTGCCCGCCGTGGCCGTCGGC
TGGGGCCTGTGGGCCGAGGCCAGCGGCATGACCGGCCATCTGGACGAGGCCGACCGGGGC
AGGATCAGCCGCGGTGGCGCCGGAGCGCTCTCCGCCGACCAGGGCCTCGCCCTCTTCGAC
GCGGCGCTCATCGCCCCCCGGGCCGCCGTGCTCGGTATGCGGCTGAACACCTCCGTCCTA
CGGGCTCAGGCCGCCAGCGGGGTACTGCCCCATCTGCTGCGCGATCTGGTACGGGTACCG
GTCCGCCGGGCCGCGTCCGCCGAGGGCGCCGGTGGTGGCGGGCTGGCCGACCGGCTCACC
GGATCGGACCCGGCCGAACAGCAGCGACTCGTCCTGGAACTGGTCCGTACGCATGTGGCC
GCCGTGCTCGGTCATACCGACGCGGAGCGGGTCGGCGCGGGCAAGGCATTCCGCGAGCTG
GGCTTCGACTCCCTGACCTCGGTGGAGTTGCGCAACCGACTCAACGCGGCCACCGGCCTA
CGGCTCCCCGCCACCCTGGTCTTCGACCACCCCACCCCCACCGCCATCGCGGAACTCGTA
CGGGAGCAGGTCCTCGGCCAGGCCACCGCCGCGCCCCACCGGCCCGCCGCTTCGCCGAAC
CGGCCGGGGCCGTCGGACGAACCGCTCGCCGTCGTGGGCATGGCCTGCCGCTTCCCCGGT
GGCGCCGGCTCGCCCGAAGAGCTGTGGAAACTGGTCATGGCGGGCGGCGACGGCATCACC
ACCTTCCCCGAGGACCGGGGCTGGGACGTCCAGGCGCTCTACGACCCGGACCCGGAGCAC
CAGGGCACCTCGTACACCTGCGAGGGCGGCTTCCTGCACGACGCCGGTGAGTTCGACGCG
GGCTTCTTCGGGATCTCCCCGCGTGAGGCGCTCGCCATGGATCCCCAACAGCGTCTTCTC
CTGGAGGCCGGCTGGCAGGCGGTCGAGAGCGCCGGAATCGACCCGCTGACGCTCAAGGGC
AGCGACACCGGCGTCTTCGCGGGCGTCATGTACCACGACTACGCCTCCCGGCTGGCGTCG
GTGCCCGAGGGCCTTGAGGGCTATCTCGGCACGGGCAACGCGGGCAGCGTGGTGTCGGGC
CGAGTGGCGTACGTACTCGGCGCCGAGGGTCCGGCGGTGACGGTGGACACGGCGTGTTCG
TCGTCGCTGGTCGCGTTGCATCTGGCGGGCCAGGCCCTGCGTCAGGGCGAGTGCTCGCTG
GCCCTCGCCGGTGGTGTCACCGTCATGTCGACGCCGGATGCCTTCGTCGACTTCAGCCGC
CAGCGGGCATTCGCACCGGACGCGCGGTGCAAGGCGTTCGCGGCGGCGGCCGACGGAACG
GGCTGGTCCGAGGGCGTCGGCGTGGTGCTCATCGAACGGCTCTCGGACGCACGGCGGCAG
GGGCATCCCATCCTCGCCGTGATTCGTTCCAGCGCCGTGAACCAGGACGGCGCCAGCAAC
GGTCTGACGGCTCCCAACGGCCCGTCGCAGCAGCGGGTGATCCGTCAGGCGCTGTCGACG
GCCGGACTGTCGACCTCCGATGTGGACGCGGTCGAGGCGCATGGCACGGGCACGAATCTG
GGTGACCCGATCGAGGCGCAGGCCCTGTTGGCCACGTACGGCCAGGGCCGGCCGGAGAGT
CTTCCCCTCCGGCTGGGCTCGCTGAAGTCCAACATCGGCCATACGCAGGCCGCCGCCGGT
GTGGCGGGTGTGATCAAGATGGTGCTGGCGCTCCAGCACGGTGTCCTCCCGGCGACCCTC
CATGTCGATGAGCCGACGCCACACGTCGACTGGGCGAGCGGCGCGGTCGAGCTGCTGACG
GAGGCGACGCCCTGGCCCGAGACCGGACGTCCGCGCCGGGCCGCGGTGTCGTCCTTCGGG
ATCAGCGGTACCAACGCGCATGTGATTCTGGAGCAGGCGCCGGACGACGGTGGCACCGAG
GTGTCCACCACGGACGATGACTCCCTGGTGCCGTGGGTGCTGTCCGGCCGTGGTGCCGAC
GGTGTCCGGGCGCAGGCCGCCCGGCTGCGCGCATGGCTGCTGGAACGCCCCGGGGCCCAC
CCGGCGGACATCGGCTCCTCCCTCCTCACCTCCCGGTCGCTGTTCGAGGACCGGCTGGTT
GTGCTGGGTTCCCAGCGTGAGGCGCTGCTCGACGGACTGGCGGCGGCTGCCGAGGGGGCG
CCGTGGCCCGGCCTGATTCAGTCGTCGGCGGATGCGTCGCTGACCCGGGCTGCGTTCGTG
TTCCCGGGTCAGGGGTCGCAGTGGGTGGGGATGGGGCGGGAGTTGTACGCGTCGTCTCCC
GTCTTCCGGGCGCGGTTGGACGAGTGCGCGCGGGCGTTGGATCCGCTGGTGGACTGGTCG
CTGATCGATGTTGTACGGGGTGAGTCCGGGGCCCCTGGTCTGGAGCGGGTGGACGTGGTC
CAGCCCGTCCTCTGGGCCGTGATGGTCTCCCTGGCGGCGGTCTGGGAGTCGTGGGGCGTG
GTCCCGGCCGCTGTGGTGGGCCACTCACAGGGTGAGATTGCCGCCGCGTGTGTGGCGGGG
GCGTTGTCCGTGGAGGATGCGGCGCGGGTCGTGGCGTTGCGGAGTCGGGCGCTGCGGGCG
ATGGCGGGTGACGGTGCGATGGTGTCCGTCGCGCTCCCGGCCGCTGAGGCTGAGGCGTTG
ACCGGGGACGGTGTGTCCCTGGCGGCTGTCAACGGTCCGTCGTCGGTGGTGCTGTCGGGG
GACCGGTCTGCCCTCACCCCCGTGGTGGAGCGGCTCAGCGCCGAGGGTGTGCGGACGAAG
TGGGTGCCGGTGGACTACGCGTCCCACTCCGCCCATATGGAGCGCATCCGTGAGGAATTG
GCGTCCCTGCTGTCCGGGATCGAGCCCAAGACCTCCCGTATCCCCCTCTACTCCACCGTG
TCGGCGCAGGTCATCGACACGTCGGTCATGGATGCCGGCTACTGGTTCGACAACATCCGG
GGCACCGTCCGCTTCCACGAGACCGTCCAGGCCCTGATCACCGACGGCCTCACCGCCTTC
GTGGAGATATCCCCGCACCCCGTCCTGGCGATGAGCGTCCAGGACACCCTCGACCAGGCC
GAGGCGAACGGCCTGTCCATCGGCACCCTGCGCCGCGACGAGAACGAACACGAAGCCTTC
CTGACCGCCGCCGCGCAACTCTTCGTCGCCGGCCTCCCGATCGACTGGCACACGGCGGCG
TTCACCGACCTCGACACGCGCCGCGTCGACCTCCCCACCTACGCCTTCCAGCGCGAGCGC
TTCTGGCTGCCGACCGGCGGAGGAGCCGTCGGTGACGCCGCCGGGCTCGGCCTCGGCACC
GTACGCCATCCGCTGCTGGGTGCCGCCGTGAGTGTCGCCGAGAACGGGACGACCCTGCTG
AGCGGTCGGATCTCGCTGCGTACGCACCCTTGGCTGGCCGACCACGCAGTCCTCGGCTCC
GTACTCCTGCCCGGCACCGCCTTCCTGGAACTGGCCGTATGCGCCGGTGACCAGGTCGGC
TGCGCACGCGTCGAAGAGCTGGTCATCCAGGCCCCGTTGGTGCTCACCGGCGACGATGCG
GCCGACCTCCAGGTCGTGGTCGGTGCCCCGGACGGGTCAGGACTCCGGGCCGTCGACATC
TACTCCCGTCCGCACAGCGGGGCGGAGTGGGCGGACGAGGCGTGGACGCTGCACGCCAGT
GGTTCCCTCGCCGCCTCGGCGGCGACCTTCCCGGACACCCCGGACGGCGCGGCCGTCGCA
GACGCGGCGGCGAACGATCTGACCGTCTGGCCGCCGCAGCAGGCGACACCCGTCGAGATC
GACGGGTTCTACGAACTCCTCGGCGGTACCGGCTTCCAGTACGGCCCGCTCTTCCAGGGC
CTGCGCGCCGCCTGGCGCAGCGGTGACGACATCTACGCCGAGGTCGGACTGCCCGAGCAC
GAGCACGCCGGCACGGACGGTTTCGGCATCCACCCGGCGCTGTTCGACGGCGCGCTGCAC
GGCATCGGCCTCGGCACCGCCACCGATGCCACCACCACCGACACCACTTCCGACGACGCC
ACCGCCACCGACACCACTTCCGATGGTGCCGCGGCCGGCCCCCGGGGACTGCTGCCGTTC
TCCTGGACGGGCGTGTCGCTGTACGCGAGCGGTGCCTCGGTCCTTCGCGTACGGCTGCGG
CGGCAGGGCGGCGACGCGGTGGGTCTGGTCGCCGCCGACCCCACTGGCGCGCCGGTCGTC
TCGGTCGACTCGCTGGTGCTGCGACCCATGACGGCCGATCAGGTACGGCCCGGAGGCGGC
GCGCGCCGCTCCCACCTGTACGCACTCGACTGGACGCCCACCGGCATCGGCGCGCCGGCG
GACGGGAGCAAGACCTGGGGCGTACTGGAGAGCCCCGTTGCCGGTGTCGTGGCGGAGGCC
GCGGCCCCGACGGCCCGGCGCGGCCCGCTGGACGCGCTGCTCGCCGACGGAGCCGTACCG
GATGTGGTCCTGCTGGCGGCGGCCGGAGTCGACAGCACCCCCGCTGCCGCTGCCGCCGAC
GCCCGTGATCTGGTCGGCTCGGTGCTGGCGACGGTCCAGGAGTGGCTGGCCGCCCCCGGT
ACCGAGGCCGCCCGGCTCGTGGTGCTCACCCGGGGCGCCGTCGCCGTCGGCTTGGACGAC
GACATCACCGATCTCGCGGCGGCCTCCGTATGGGGCCTGCTCCGGGTCGCCCAGAACGAG
CACCCGGACCGCTTCGTCCTCGTGGACGCCGATGCGGCGGCGGTGGCGTCCGGCGCCGTA
CGGGATGCCGTGGAGCTGGACGAACCTCAGATCGCACTGCGCGGTGACACCGTGTACGTA
CCCCGGGTGCACCGGGCTCCGGCCGGGGCCGACGACGGGCCGCGCGACTGGGACGTACCC
GGTACGGTCCTGGTGACCGGCGGTACCGGCACCCTGGGTACCGCGGTCGCGGAACACCTC
GCGGCGGGCGGCGCACGGCGGTTGCTGCTGGTCAGCCGACAGGGCCCGGCCGCGCCCGGC
GCCCGCGAACTCGCCGCGCGGCTCACGGCCGCCGGCACCGAGACCGAGGTGGCTGCGTGC
GATGTCGCCGACCCGGCGGCGCTCGCCGGACTGCTCGCGACGATCCCCACCGGGCAGCCG
CTGACGGCCGTGGTGCACGCCGCGGGCGCACTGGACGACGGGATCCTGGAATCGCTCACT
CCGGAGCGGATCGCGTCCGTCTTCGCGCCGAAGGCGGACGCCGCCTGGCACCTGCACGAG
CTGACGGCCGATCTGCCGCTGACCGCGTTCGTCCTCTTCTCCTCAGCGGCCGGCACCTTC
GGCAGCGCCGGACAGGGCAACTACGCCGCGGCCAACGCCTTCCTGGACGGCCTGGCCCAG
CACCGGCGCGCCCGCGGCCTGCCCGCGGTCTCCCTCGGCTGGGGCCTGTGGGCCGAGACC
AGCGCGCTGACCGGGCAGCTCAGCCAGGGCGACCGGGACAGGATGGACCGGACCGGCGCC
GGCGCGCTCAGCACCGATGAGGGCCTGGCGCTGCTCGACACGGCGGCCGGCACCCCGCGC
GCCGCGCTGCTGCCGATGCGGATGAACACGGCCGCACTGCACGCCCAGGCCAACTCCGGC
GCGCTGCCGCACCTGCTGCGCGATCTGGTCCGGGTACCGGCGCGGCGCACCGCGGCGGGT
GACGCGGGCACCGGCAATCCGCTCGCCGCCCGACTCGCGGGCCGGACCGGCCCCGAGCGG
CAGCGGATCGTCCTCGATCTGGTACGCGGCCACGTCGCGGCCGTCCTCGGCCACAGCGAC
CCCAAGGGCGTCGGCGCCCAACGGGCCTTCCGTGACCTGGGCTTCGACTCGCTGACCGCC
GTGGAGCTGCGGAACCGCCTCAGCGCCGCCACCGCGATCCGGCTGCCCGCCACCCTGATC
TTCGACTGCCCGACCCCGGCGGCCATCGCCGACTTCGTCCTCGAACGGGCCCTGGGCCAG
GGTGAGCACACGGACCGGCCGCGCACGGTGGCGACCACAACCGACGAGCCGATGGCCGTG
ATCGGGATGGCCTGCCGCTTCCCCGGTGGGGTGGCGTCGCCGGAGGACCTGTGGCGGCTG
GTCGCGGAGGGCCGGGACGGCATCTCCGGCTTCCCGGCCGACCGCGGCTGGGACCTGGCC
AACCTCTACCACCCCGACCCCGATCACGAGGGCACCACCTACACCCGCGAGGGCGGCTTC
CTCCACGAGGCGGGCCGGTTCGACCCCGGCTTCTTCGGGATCTCGCCGCGCGAGGCGGTG
GCCATGGACCCGCAGCAGCGGCTGCTGCTGGAATCGTCCTGGGAGGCGATCGAGAGCGCC
GGGATCGACCCGCTGACCCTGCGGGGCACCGACACCGGTGTCTTCGCCGGGCTGATGTAC
CACGACTACGCCGTCCAGCTCGCCGCCGTACCGGAGGGCGCGGAGGCGTTCCTGGGCATC
GGCAACGCGGGCGGTGTCGCCTCCGGCCGGGTCGCGTACGTCCTCGGCACCGAGGGCCCG
GCCGTCACGGTGGACACGGCGTGCTCCTCGTCGCTGGTCGCCCTGCACTGGGCGGCACAG
GCGCTCCGCCAGGGTGACTGCTCGCTGGCGCTCGCCGGCGGTGTCACGGTCATGGCCACC
CCCGGTGCCTTCGTCGACTTCAGCCGTCAGCGCGGCCTCGCCGCCGACGGTCGGTGCAAG
TCCTTCGCGGCCGGCGCCGACGGCACCGGCTGGGCCGAGGGCGTCGGTATGGTGCTGCTG
GAGCGGCTCTCCGACGCACAGCGGCTCGGCCACCCCGTCCTCGCGGTGATCCGCTCCAGT
GCCGTCAACCAGGACGGCGCCAGCAACGGCCTGACCGCCCCGCACGGCCCCTCGCAACAG
CGGGTCATCCGGCAGGCGCTCGCCTCGGCCGGTCTCTCCGCCGCCGATGTCGACGCCGTC
GAGGCCCATGGCACCGGCACCACGCTCGGCGACCCGATCGAGGCCCAGGCGCTCCTGGCC
ACGTACGGCCAGAACCGTCCCGAGGACCGGCCGCTGCGGCTCGGCTCGCTGAAGTCGAAC
ATCGGCCACGCCCAGGCCGCCGCCGGTGTCGCCGGTGTCATCAAGATGGTGATGGCACTG
CGGCACGGTGTGCTCCCCGCGACCCTCCATGTCGATGAGCCGACGCCGCACGTCGACTGG
GCGAGCGGGGCCGTGGAACTCCTGGCCGAGTCCATGCCGTGGCCCGAGACGGGCCGGCCG
CGCCGCGCCGCGGTGTCCTCGTTCGGGATCAGCGGCACCAACGCCCACACCATCCTCGAA
CAGGCCCCCGAGATCGCTCCCGTGCCCGCCGTCGAACCGGCGACCGTCCTCCCCGGCCCG
GTGCCGTGGGTGGTCACCGGCCGCGGCCCAGCAGGGCTGCGCGGACAGGCCGCCCGGCTC
GCCGAATGGGCGCGCACGCACCCGGAGGCGGACGCCGCCGATGTGGCCCGCTCCCTGGTC
ACCGCCCGGTCGGCGTTCGACGAGCGGTTGGTCGTCCTCGGTGCGGACCGCGAAGCCCTG
ATCGCGGGAGTGACGGCGGTGGGCCGGGGCGAACCCTGGCCCGGCGCGGTCCGCAGCGCC
CCCGGTGGCCTCGCCGCCGGGAGCGTGGGCCTGCTCTTCGCCGGACAGGGCTCGCAGCGG
CCCGGCATGGGACGTGAACTGGCCGCCGCCGCACCGGTGTTCGCCGCCGCCCTGGACGAG
GTCTGCGCCGCCCTGGATCCGCACCTGGACCAGCCGCTGCGGGATGTCCTGTTCGCCGAG
CCGGACACCCCGCTCGCCGCCCTGCTGGACCGCACCGGCTGGACCCAGCCCGCCCTGTTC
GCCGTCGAGGTCGCCCTCTTCCGGCTGCTCCGGTCCTGGGGTGTCACCCCCGACTTCGTG
GCCGGGCACTCCATCGGCGGACTCGCCGCCGCCCACACGGCGGGGGTGCTGTCACTCGCC
GACGCGGCGACCGTCGTCGCCGCCAGGGGCCGGCTGATGCAAGCACTGCCCGAGGGCGGC
GCCATGGCCTCCCTCCAGGCCACGGAGGACGAGGTCACCGCGGAGCTGGCGGCATTCGAC
GGCCGGGTGTCGATCGCGGCCGTCAACGGTCCGCAGGCCGTGGTGGTCTCCGGCGACGAG
GACGCCGTCGACGAGATCGCGGCCCACTGGCGGGAGCGGGGACGCAAGGCCAAGCGGCTG
AAGGTCAGTCACGCCTTCCACTCCTCCCGGATGGAACCCGTGCTGGCGGAGTTCGAGCGG
ATCCTCGCCTCGGTCACCCTCCACCCGCCGGTGATCCCCGTCATCTCCGACACCACCGGC
GAGCCGCTGACCGACGCGGAGGCGACCTCGCCCCGCTACTGGGCCGAGCACATCCGCCGC
CCGGTCCGTTTCCACCAGGTGGTCACCACCCTCGCCGCCCACGGCGCCGACCGGCTCGTC
GAAATCGGACCGGACGGCGTGCTCAGCGCGATGGCACAGCAGAGCCTCACCGGTGACGCG
GCGGCCGGCACCGTGGTGGTGCCCCTGCTGCGTACCGACCGCGACGAGTACGAGGCCGCG
CTCACCGCGGCCGCCACCCTGTTCGTCCACGGCACCCCCGTGGACTGGCCCGCACTGCTC
CAGCCGCTCGACGGGCGCCGGGTGGCCCTGCCCACCTACGCCTTCCAGCACGAGCGGTAC
TGGCTGGAGGCGCGTACCAGCGCGGCCGACCCCGTCCCGGCCCACCACGACGCCGACTCC
CCGTTCTGGGAGGCGGTCGAGCGCGGCGACGCCTCGGTGCTCGCCGAGACCTTCGCCTCC
GCCGGAGTGCGGGCCCCGGCGGAAGCCTGGGCGCCCGTGCTGCCCGCCCTCGCCTCGTGG
CGGGGGACCCGGCACGGCCGGACCACCGCCGACACCTGGCGCCACCGGGTCACCTGGAAA
CCCCGCACCCGTACCCCCGCCGCCGTACTGACCGGCGACTGGCTGCTGATCGCGCCCGTC
CAGCCGGAGCACAAGGAACTCACCGACCACTGCGCGGACGCCCTGGCACGGCACGGCGCG
ACGGTGACCCTCCTCCGGCCCGACCAGCTCGACCCGGACGACCGTTCGGCCTGGCGCGTC
CTGCTGGACGAAGCCGTACAGCGGACCGGAACGGTCTCGGGCGTGGTGTCGCTCATCGGC
CTGGTCGAGGAAGCACACCTCCGCCATCCGTCCGTCCCCGTCGGTCTGGCCGCGACCCTG
GCGCTGGTGCAGGGTCTCGGCGACGCCGGAGTCGACGCCCCGCTGTGGTGCCTGACCCGG
GGCGCGGTCTCCACCAGCGGCACCGACCCGCTGCACTCGCCCGTCCAGGCCCTGCTGTGG
GGACTCGGCCGGGTCGTGGGGCTGGAACACCCCGAGCGCTGGGGCGGACTGGTCGACCTC
CCGGAGGAGACCGGCACCCACTGCTGGGAGCAGCTCTGCGGGATCCTCGCCGCCGCCGAC
GACGAGGACCAGCTCGCCGTACGCCCCGCCGGGGTGTTCCTGCGCCGACTCACCCCCGCG
CCCGCGACCGGATCCTTGGACCGGGACGGAAGCTGGACCCCGCACGGCACCGTACTGATC
ACCGGCGGCACCGGGGTGCTCGGCGCCCAGCTCGCCCGCTGGGCGGTCGCCGCGGGGGGA
CGCAGTCTGCTGCTGCTCAGCCGCCGCGGGCCCGACGCCCCCGGCGCCGCTGCGCTCCGT
ACGGAACTGGAGGCCGCCGGAGCCCGGATATCCATCGTCTCCTGCGACATCACCGACCGG
GCCGCGCTGCAACGGGCCGTGGCCACCGTGCCCGACGAACACCCGCTGACCACCGTCATC
CACGCCGCCGGAGTCGATGTCCACCAGTACGAGCCCGCCGCCGGGCTCACGCTGGACCTG
CTCGCCCCGGTGGTGGAGGCCAAGGTCGCCGGGGCCCGCGCCCTGGAGGACCTGATCGCG
GACCAGCCGCAGATCGAATCGTTCGTCCTCTTCTCCTCCGGCGCCGGGATCTGGGGCGGC
GGCGGACAGGGTTCGTACGCGGCCGGTAACGCCTTCCTCGACGCCCTGGCGGAACACCGG
CGCGGCCGGGGGCTACCCGCGACCGCGATTGCCTGGGGACCCTGGGGTGAGGACGAGACC
GGCGACGACAACGACGCCGCCCGCCGGCAGATGGACCGTCGCGGGCTGCCCGCGATGTCA
CCGGAGCTGGCCCTGCGGGCCTTCCGCCGGATCCTCGACCACGACGAGATCGCGCTCACC
GTGGCCGATATCGACTGGGAGCGCTTCTACCCGGCGTTCGCGCTCTCCCGGCCGCGCCCA
CTGCTGCACGACGTCCCCCGGGTCGCCGAGCTGCTCACCGATTCGGCCGCCCCCGCCACC
TCCGGCGGACGGCCGGCCCTGGTCGAACAACTCCTCGGCACACCCCCCGCCGAGCAGCGG
CATCTGGTGCTCGTGGCCGTACGCACCGAAGTGGCGGCCGTCCTCGGACACGACCCGGAC
GGCATCGGCGCCAACCGGGCCTTCCGGGACCTGGGCTTCGACTCGCTGACCGCGGTCGAG
CTGAGCCGGCGTCTCGCACCGGTCACCGGGCTCCAACTGCCGCCGACGCTGGTCTTCGAC
CACCCGACACTGGCGGATGTCGCCGCCGACATCCATCAGCGGCTGACCGACGCCACCGCC
GAACTCTTCGTCACGCTGGACCGATTGGAGAGCAGGCTCGCCGATTCGGTGCTCGACGCC
GACCTGGGCCGGGCGGCGGTGGACCGACTGTCCCTCGCCCTCGCCCGGCTCAAGGAACTC
GTCGCGGACGGGGACGAGCCGAACCGCGCCGATACCGCCGCGAACATCGACGACGCCACC
GACGAGGAGATCTTCGAACTGCTCGACCGGGAGCTGTAA
[15] KS34..410
[15] AT571..885
[15] methylmalonyl-CoA759..763
[15] DH936..1115
[15] KR1448..1627
[15] ACP1731..1801
[16] KS1827..2203
[16] AT2359..2672
[16] methylmalonyl-CoA2546..2550
[16] DH2723..2901
[16] KR3241..3420
[16] ACP3524..3594
[17] KS3616..3992
[17] AT4152..4473
[17] malonyl-CoA4344..4348
[17] KR4796..4978
[17] ACP5083..5152
[15] KS100..1230
[15] AT1711..2655
[15] methylmalonyl-CoA2275..2289
[15] DH2806..3345
[15] KR4342..4881
[15] ACP5191..5403
[16] KS5479..6609
[16] AT7075..8016
[16] methylmalonyl-CoA7636..7650
[16] DH8167..8703
[16] KR9721..10260
[16] ACP10570..10782
[17] KS10846..11976
[17] AT12454..13419
[17] malonyl-CoA13030..13044
[17] KR14386..14934
[17] ACP15247..15456

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [562-694]  G3DSA:3.40.366.10 [759-876]  G3DSA:3.40.366.10 [2355-2481]  G3DSA:3.40.366.10 [2546-2663]  G3DSA:3.40.366.10 [4148-4276]  G3DSA:3.40.366.10 [4344-4463]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1759-1774]  PS00012 [3552-3567]  PS00012 [5110-5125]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1734-1800]  2.6e-12 PF00550 [3527-3593]  4.5e-12 PF00550 [5086-5149]  2.4e-13 PF00550
PF00550   PP-binding
 [1731-1801]  PS50075 [3524-3594]  PS50075 [5083-5152]  PS50075
PS50075   ACP_DOMAIN
 [1724-1843]  3.30000526807186e-30 SSF47336 [3517-3632]  7.19999557654549e-29 SSF47336 [5075-5169]  1.70000295590054e-22 SSF47336
SSF47336   ACP_like
 [1729-1804]  3.39999999999996e-67 G3DSA:1.10.1200.10 [3523-3596]  3.39999999999996e-67 G3DSA:1.10.1200.10 [5084-5157]  3.39999999999996e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1448-1626]  1.40000000000001e-63 PF08659 [3241-3419]  1.40000000000001e-63 PF08659 [4796-4977]  5.10000000000004e-56 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  9.9e-96 PF00109 [1827-2077]  1.39999999999997e-95 PF00109 [3616-3866]  2.30000000000004e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  2.89999999999999e-47 PF02801 [2085-2203]  3.60000000000002e-47 PF02801 [3874-3992]  4.39999999999997e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [571-885]  2.30000000000004e-109 PF00698 [2359-2672]  1.39999999999997e-108 PF00698 [4152-4473]  3.99999999999998e-72 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2.1e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-868]  3.89999861795218e-73 SSF52151 [2356-2655]  3.10001307370203e-73 SSF52151 [4148-4457]  1.3000049540733e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-758]  1.20000117458134e-16 SSF55048 [2483-2545]  1.20000117458134e-16 SSF55048 [4278-4343]  3.39999972437717e-20 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-296]  G3DSA:3.40.47.10 [298-462]  G3DSA:3.40.47.10 [1830-2089]  G3DSA:3.40.47.10 [2091-2254]  G3DSA:3.40.47.10 [3619-3878]  G3DSA:3.40.47.10 [3880-4044]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-406]  1.39999277195148e-102 SSF53901 [1819-2201]  6.19996040581186e-100 SSF53901 [3608-3990]  2.59998233910302e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1447-1643]  1.9e-102 G3DSA:3.40.50.720 [3242-3426]  5.69999999999998e-108 G3DSA:3.40.50.720 [4796-5022]  5.69999999999998e-108 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1990-2006]  PS00606 [3779-3795]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [573-867]  3.49999466863949e-129 SM00827 [2360-2654]  1.99997879312421e-130 SM00827 [4152-4454]  5.6999970878395e-130 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1732-1804]  3.89999861795218e-36 SM00823 [3525-3597]  2.80000504261099e-34 SM00823 [5084-5155]  5.49999338756182e-30 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [936-1115]  3.49999466863949e-82 SM00826 [2723-2901]  8.39998014024973e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825 [1829-2255]  SM00825 [3618-4044]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1448-1627]  1.99999636034521e-64 SM00822 [3241-3420]  2.1000026783403e-62 SM00822 [4796-4978]  5.00000909915354e-42 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit