close all open/close all
first first   Hecto_00020 Hecto_00020

CDS information : Hecto_00010


close this sectionLocation

Organism
StrainJHB
Entry nameHectochlorin
Contig
Start / Stop / Direction2,444 / 4,264 / + [in whole cluster]
2,444 / 4,264 / + [in contig]
Location2444..4264 [in whole cluster]
2444..4264 [in contig]
TypeCDS
Length1,821 bp (606 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative carboxylic acid--ACP ligase
putative acyl-ACP synthetase
Product (GenBank)HctA
GenehctA
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • acyl-ACP synthetase
Reference
ACC
PmId
[18001088] Cloning and biochemical characterization of the hectochlorin biosynthetic gene cluster from the marine cyanobacterium Lyngbya majuscula. (J Nat Prod. , 2007)
Related Reference
ACC
Q6E7K9
PmId
[15217615] Structure and biosynthesis of the jamaicamides, new mixed polyketide-peptide neurotoxins from the marine cyanobacterium Lyngbya majuscula. (Chem Biol. , 2004)

close this sectionPKS/NRPS Module

0
A41..488

close this sectionSequence

selected fasta
>putative carboxylic acid--ACP ligase [HctA]
MNTKKKFTSLIHLLCYRGTNKPNQKAYTFIGNGKTETASLTYGELEKRSRAIAAQLQEMG
VTRGERALLLYSQPLDFICAFFGCLYAGVIAIPAPPPDAIRLKRTLPRLQACVKDAQVSL
VLTTSQIYSQFPSEWQKDFEYNNMLLWLFTEEISEQLANQWQELKINLDAIAYLQYTSGS
TSTPKGVIVTHNNVMHHSAYIKQAWNYTSDSIAATWMPYFHDYGLIDGLIQPIYSGITCY
VMSPLTFVRRPTCWLEVISKYKVTHSQSPNFGYDYCVRQVTSEQLNNLDLRSWKTASNGA
EPIRKDTIEKFIKTFEPCGFRATAFFPSYGLAEATLLVATKSHNDVPEIASIAASALEKN
QIVECDGNQKGTRYVVSCGFPICGIKVIIINPNTLTRCASDEVGEIWVSDLSVAQGYWNR
PEETKHTFEAYLADTGEGPFLRTGDLGFIKNGQLFVTGRLKDVIIIRGQNHYPQDLEFTV
EQSHPALRKNSEAAFGIEVDGEEKLVVVQEVERSWLRKLDFDQVNGDIRQALMEQHELQV
YAIALIKPGSIPKTSSGKIMRHACRIKFLEGTLEVINSGGGNPEHLRRLTVMSVMRATPK
NGAHLG
selected fasta
>putative carboxylic acid--ACP ligase [HctA]
ATGAATACTAAGAAAAAATTTACCTCTTTGATACACCTGCTATGTTATAGAGGAACAAAT
AAACCGAACCAAAAAGCCTATACCTTTATTGGTAATGGAAAAACAGAGACAGCCAGCTTG
ACTTATGGAGAATTGGAAAAGCGGTCACGAGCAATCGCAGCTCAGCTTCAGGAGATGGGG
GTAACCAGGGGGGAACGAGCATTGCTGCTCTATTCACAGCCTCTAGATTTTATTTGTGCT
TTCTTTGGATGTTTATATGCAGGAGTTATTGCTATTCCGGCTCCTCCACCTGATGCAATT
CGATTGAAGCGAACTCTGCCTCGACTTCAAGCTTGTGTTAAGGATGCCCAAGTTTCTCTA
GTGCTGACTACATCTCAAATTTATTCTCAGTTCCCAAGTGAATGGCAAAAAGACTTTGAG
TATAATAATATGTTGTTATGGTTGTTTACTGAGGAGATATCAGAGCAACTAGCAAACCAA
TGGCAAGAATTAAAAATTAATCTAGATGCCATAGCTTATTTACAGTATACTTCTGGGTCT
ACATCTACACCGAAAGGAGTCATAGTGACCCATAACAATGTAATGCACCATTCTGCCTAT
ATCAAGCAAGCATGGAACTACACTTCAGATAGTATTGCTGCTACTTGGATGCCTTACTTC
CATGATTATGGTTTGATTGATGGACTTATACAGCCTATTTATTCTGGTATTACTTGTTAC
GTAATGTCACCATTGACATTTGTGAGAAGACCGACCTGCTGGCTAGAGGTTATTTCTAAG
TATAAGGTAACCCATAGCCAAAGTCCAAACTTTGGCTATGACTACTGTGTTCGTCAAGTT
ACATCAGAACAATTAAATAATTTAGATCTTAGGAGTTGGAAAACAGCTAGTAATGGAGCA
GAGCCAATTCGTAAAGACACTATAGAAAAATTTATTAAAACATTTGAACCTTGTGGGTTC
CGTGCCACAGCTTTTTTTCCATCTTATGGTCTTGCAGAAGCAACTTTGTTAGTTGCTACC
AAGTCTCATAATGATGTGCCTGAAATTGCATCAATTGCTGCATCAGCACTAGAGAAAAAT
CAGATTGTTGAGTGCGATGGTAATCAAAAGGGAACTCGATATGTGGTTAGTTGTGGTTTC
CCGATTTGTGGAATAAAAGTAATTATCATCAATCCCAATACTTTAACTAGGTGTGCGTCA
GATGAAGTTGGCGAAATTTGGGTATCAGATTTGAGTGTTGCTCAAGGTTATTGGAATAGA
CCAGAAGAAACAAAGCATACATTTGAGGCATATCTAGCAGATACTGGTGAAGGTCCATTT
CTACGTACTGGTGACTTGGGGTTCATCAAGAATGGTCAGCTGTTTGTCACTGGGCGCTTG
AAGGATGTAATCATCATTCGAGGTCAAAATCATTATCCTCAGGATCTTGAATTTACGGTT
GAACAGAGCCACCCAGCACTGCGTAAAAATTCTGAGGCAGCATTTGGGATTGAGGTAGAT
GGCGAAGAGAAATTAGTCGTTGTTCAGGAGGTGGAGCGAAGTTGGCTGCGAAAACTGGAT
TTCGATCAAGTAAATGGAGATATTCGTCAGGCGTTGATGGAGCAACACGAACTACAGGTT
TATGCAATAGCATTGATCAAACCAGGTAGCATTCCTAAAACTTCAAGTGGCAAGATAATG
CGTCACGCTTGTCGGATTAAGTTTCTAGAGGGAACTTTGGAAGTTATAAATTCAGGTGGT
GGTAATCCAGAACACTTAAGAAGACTAACTGTTATGAGTGTTATGAGGGCAACTCCAAAA
AATGGGGCGCATCTGGGGTAG
[0] A41..488
[0] A121..1464

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [41-488]  9.60000000000004e-89 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [174-185]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit
first first   Hecto_00020 Hecto_00020