close all open/close all

CDS information : Hecto_00020


close this sectionLocation

Organism
StrainJHB
Entry nameHectochlorin
Contig
Start / Stop / Direction5,267 / 6,721 / + [in whole cluster]
5,267 / 6,721 / + [in contig]
Location5267..6721 [in whole cluster]
5267..6721 [in contig]
TypeCDS
Length1,455 bp (484 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)HctB
GenehctB
Gene (GenBank)
EC number
Keyword
  • dichlorination
Note
  • Along with dichlorination, this ORF catalyzes oxygenation and introduction of a vinyl-chloride moiety into the nonactivated carbon chain.
Note (GenBank)
  • putative halogenase
Reference
ACC
PmId
[18001088] Cloning and biochemical characterization of the hectochlorin biosynthetic gene cluster from the marine cyanobacterium Lyngbya majuscula. (J Nat Prod. , 2007)
[24497159] More than just a halogenase: modification of fatty acyl moieties by a trifunctional metal enzyme. (Chembiochem. , 2014)
[24847780] The role of chloride in the mechanism of O2 activation at the mononuclear nonheme Fe(II) center of the halogenase HctB. (J Am Chem Soc. , 2014)
Related Reference
ACC
Q9RBY6
PmId
[16002467] SyrB2 in syringomycin E biosynthesis is a nonheme FeII alpha-ketoglutarate- and O2-dependent halogenase. (Proc Natl Acad Sci U S A. , 2005)
[16541079] Crystal structure of the non-haem iron halogenase SyrB2 in syringomycin biosynthesis. (Nature. , 2006)
[19245217] Substrate-triggered formation and remarkable stability of the C-H bond-cleaving chloroferryl intermediate in the aliphatic halogenase, SyrB2. (Biochemistry. , 2009)
[19815524] Substrate positioning controls the partition between halogenation and hydroxylation in the aliphatic halogenase, SyrB2. (Proc Natl Acad Sci U S A. , 2009)
[23868262] Elucidation of the Fe(IV)=O intermediate in the catalytic cycle of the halogenase SyrB2. (Nature. , 2013)
[24463698] Direct nitration and azidation of aliphatic carbons by an iron-dependent halogenase. (Nat Chem Biol. , 2014)

close this sectionPKS/NRPS Module

0
Hal1..329
ACP391..464

close this sectionSequence

selected fasta
>polyketide synthase [HctB]
MLTQNQIQHFEEKGWLGPLDIFTSSEVESVKKCIEANSSIKEVEDQPMMMLYNNVLNLNT
SRDLHLFHQPIAEMFKNNKIVRVLNQLGGDNLLLWNSNVFCKMPGEGEIKWHQVYDSYDP
SAYDPQKPALLYPNNEEIINISVWIALDDATLENGCLHFANGTHKEKFGRIQVPAEEGMF
AGIKNHKMVWQGRRKYSIVFDFDDNEWEVEAVPARMGQAIIFTERVMHSSPPNKSKQQRR
LGINGRYVPPSVQVYPHRLKGDFIDENFHNIKKHFCILVSGQDDYGINVVRDSHDLDNIE
LEFQTMSNLVRFGHVQLPKGKKEIELETLYQQAMEGDCLEEEPDPILQPRKYIQWQAWNQ
LKGMSCSEAMKQYSQIVAKLPVVDQERELPLEEKIKAWLVAYIAKVFNIQPDEVNSTLPF
ERYALGSAESATLVAELGAWLERDIPATALYSYPTIEFLAKHLANSREAPRCTDRVSVGM
TARQ
selected fasta
>polyketide synthase [HctB]
ATGCTCACACAAAACCAGATTCAACACTTTGAAGAAAAGGGATGGTTAGGCCCCCTGGAT
ATATTTACAAGTTCAGAAGTAGAATCTGTAAAAAAATGTATAGAAGCTAATAGTTCAATT
AAAGAAGTAGAGGATCAGCCGATGATGATGCTCTACAACAATGTCCTGAACCTCAACACA
TCTCGTGACCTTCATCTGTTTCATCAACCGATAGCCGAGATGTTTAAAAATAACAAAATT
GTTCGGGTACTAAACCAGTTGGGTGGGGACAATTTACTATTATGGAACAGTAATGTTTTT
TGCAAAATGCCAGGGGAAGGAGAGATCAAATGGCATCAAGTTTATGATTCTTACGACCCC
AGCGCCTATGATCCTCAAAAGCCAGCACTGCTTTACCCCAATAATGAAGAGATTATAAAT
ATATCCGTATGGATAGCTTTAGATGATGCTACTCTCGAAAATGGCTGCTTACATTTTGCT
AATGGGACACACAAGGAAAAATTTGGGCGAATCCAGGTACCTGCTGAAGAGGGAATGTTT
GCAGGTATAAAAAACCATAAAATGGTTTGGCAAGGGCGGAGAAAATACTCAATAGTGTTT
GACTTCGATGACAATGAATGGGAAGTGGAAGCTGTCCCAGCGCGCATGGGGCAAGCTATT
ATTTTTACCGAAAGAGTTATGCATTCCTCTCCCCCCAATAAGTCCAAGCAACAACGCCGA
CTAGGTATTAATGGACGTTATGTTCCTCCCAGCGTACAGGTTTATCCACACCGTTTAAAA
GGCGATTTCATTGACGAAAATTTTCATAATATCAAAAAGCATTTTTGTATCCTGGTATCA
GGGCAAGATGATTATGGAATCAATGTCGTTCGTGATTCTCATGATCTAGACAATATAGAG
TTAGAATTTCAGACCATGTCCAACTTAGTTCGCTTTGGTCATGTTCAACTACCTAAAGGC
AAGAAAGAAATAGAGCTTGAGACTCTCTATCAACAAGCAATGGAAGGGGATTGTCTAGAG
GAGGAGCCAGATCCGATTCTGCAACCTAGAAAGTATATTCAATGGCAAGCCTGGAATCAA
CTTAAAGGCATGAGTTGCAGTGAGGCGATGAAGCAATACAGTCAAATAGTAGCCAAACTG
CCAGTAGTGGATCAAGAAAGGGAGCTGCCTCTAGAAGAAAAAATTAAAGCTTGGTTAGTC
GCTTACATAGCCAAAGTTTTTAACATTCAACCAGATGAGGTGAATAGTACTCTTCCTTTT
GAGCGCTATGCTCTAGGATCGGCTGAGTCAGCAACTCTAGTTGCTGAGTTGGGAGCTTGG
CTAGAACGAGATATTCCTGCTACTGCGCTTTATAGTTACCCAACAATAGAGTTTTTGGCT
AAGCATTTAGCTAATTCGCGAGAAGCCCCGCGCTGTACCGATAGGGTCAGCGTCGGGATG
ACAGCGAGGCAATGA
[0] Hal1..329
[0] ACP391..464
[0] Hal1..987
[0] ACP1171..1392

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000582 Acyl-CoA-binding protein, ACBP (Domain)
 [303-380]  1.7e-12 PF00887
PF00887   ACBP
 [299-380]  3.00000067992871e-16 SSF47027
SSF47027   ACBP
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [10-240]  6.50000000000001e-21 PF05721
PF05721   PhyH
IPR009081 Acyl carrier protein-like (Domain)
 [391-464]  PS50075
PS50075   ACP_DOMAIN
 [398-463]  1.6e-05 PF00550
PF00550   PP-binding
 [392-470]  2.09999806691534e-10 SSF47336
SSF47336   ACP_like
 [393-466]  1.7e-09 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle (Domain)
 [300-380]  6.60000000000002e-16 G3DSA:1.20.80.10
G3DSA:1.20.80.10   ACBP
SignalP No significant hit
TMHMM No significant hit