close all open/close all

CDS information : Hecto_00030


close this sectionLocation

Organism
StrainJHB
Entry nameHectochlorin
Contig
Start / Stop / Direction6,964 / 8,190 / + [in whole cluster]
6,964 / 8,190 / + [in contig]
Location6964..8190 [in whole cluster]
6964..8190 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)HctC
GenehctC
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • putative transposase
Reference
ACC
PmId
[18001088] Cloning and biochemical characterization of the hectochlorin biosynthetic gene cluster from the marine cyanobacterium Lyngbya majuscula. (J Nat Prod. , 2007)
Family/Domain
FD
IPR021027, IPR001959, IPR010095

close this sectionSequence

selected fasta
>putative transposase [HctC]
MTTMRAAYQYQLRLTKSQVTKIEKWLDLLRCQYNYLLADRFNWHEQNRCSLSSCPLVCHL
PELRDNPDYFSQKRTLPQLKKDRPWYSDIQSQVLQDCVKRVDLAFKRFLKGDSNGKRSGR
PRFKSQSRYKSLTFPSLSKTPINGNILTLPKFGKVKMIYHRPIPDGFKVKTATITRKADG
YYVTLSIQDDTTPEILPVESVTNPIGIDMGLKSFLVKSDGSEIPIPQYYRKAQKRLKKIQ
KAVSRSKKGSKNRNKAISKLGKAHKKVADTRKDFHFKTAKNLLDNHDLVAHEKLNIKGLA
RTKLAKSVLDAGWGQFLSILSNKAENAGLITKAVNPRNTSQNCSNCGQKVPKELKDRIHS
CPHCGYTADRDVNAAKNILNLAVGHPVGNKAYRVTEPLGGVGKKPALP
selected fasta
>putative transposase [HctC]
ATGACAACAATGAGAGCAGCGTATCAGTACCAGTTGAGATTGACGAAAAGTCAGGTTACT
AAAATAGAAAAGTGGCTAGATCTGCTTAGGTGTCAATATAACTACTTACTGGCAGACAGA
TTTAACTGGCATGAACAAAACCGATGTTCTCTGAGTTCCTGTCCTCTTGTTTGTCATTTA
CCAGAACTAAGAGACAATCCAGACTATTTTTCCCAAAAAAGAACATTACCTCAACTCAAG
AAAGATAGACCTTGGTACTCGGATATCCAATCTCAAGTCTTGCAAGATTGTGTAAAACGA
GTTGACTTAGCCTTTAAACGATTCCTAAAAGGAGACAGCAATGGAAAAAGGAGCGGAAGA
CCCAGATTCAAAAGTCAAAGTAGATATAAGTCTCTTACTTTTCCTTCTTTGTCTAAAACT
CCTATAAATGGAAATATCTTGACTCTTCCTAAATTTGGAAAGGTCAAGATGATATATCAT
CGACCTATCCCTGACGGCTTTAAGGTAAAAACAGCGACCATAACACGGAAGGCTGACGGT
TATTACGTGACGCTTTCGATCCAAGATGACACTACTCCGGAAATATTGCCAGTAGAAAGT
GTAACCAATCCCATTGGGATAGACATGGGACTCAAATCCTTCTTGGTCAAATCTGATGGT
TCAGAGATTCCCATCCCTCAGTACTACCGAAAAGCCCAGAAGCGATTAAAGAAAATACAA
AAAGCAGTTAGCCGTTCCAAAAAGGGAAGTAAAAACAGGAATAAAGCTATATCTAAGTTA
GGAAAAGCTCACAAGAAAGTAGCTGACACCAGAAAAGATTTTCATTTTAAAACAGCAAAG
AATTTACTAGATAATCATGACCTAGTAGCTCATGAAAAGTTGAACATAAAGGGGCTGGCT
AGGACTAAACTAGCTAAGTCAGTGCTAGACGCTGGGTGGGGGCAATTCCTCTCTATACTG
TCGAACAAAGCCGAAAATGCTGGTTTGATAACGAAAGCAGTAAATCCTCGAAACACCAGT
CAAAACTGCTCTAATTGTGGGCAAAAAGTTCCCAAGGAATTGAAAGACCGCATTCATTCT
TGTCCTCATTGTGGATATACAGCGGATAGAGACGTGAACGCGGCTAAAAATATATTGAAT
TTGGCGGTGGGGCATCCCGTCGGAAATAAAGCTTACCGAGTAACCGAACCGTTAGGTGGT
GTTGGTAAGAAGCCCGCGTTGCCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001959 Transposase, probable, IS891/IS1136/IS1341 (Domain)
 [84-301]  8.20000000000006e-35 PF01385
PF01385   OrfB_IS605
IPR010095 Transposase IS605, OrfB, C-terminal (Domain)
 [313-380]  1.6e-24 PF07282
PF07282   OrfB_Zn_ribbon
IPR021027 Transposase, putative, helix-turn-helix domain (Domain)
 [4-48]  1.7e-10 PF12323
PF12323   HTH_OrfB_IS605
SignalP No significant hit
TMHMM No significant hit