close all open/close all

CDS information : Hecto_00050


close this sectionLocation

Organism
StrainJHB
Entry nameHectochlorin
Contig
Start / Stop / Direction14,019 / 24,089 / + [in whole cluster]
14,019 / 24,089 / + [in contig]
Location14019..24089 [in whole cluster]
14019..24089 [in contig]
TypeCDS
Length10,071 bp (3,356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)HctE
GenehctE
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • nonribosomal peptide synthetase; C-A-KR-PCP-Cy-A-Ox-A-PCP
Reference
ACC
PmId
[18001088] Cloning and biochemical characterization of the hectochlorin biosynthetic gene cluster from the marine cyanobacterium Lyngbya majuscula. (J Nat Prod. , 2007)
Related Reference
ACC
A4D936
NITE
Crypto_00040
PmId
[21823639] Chemoenzymatic synthesis of cryptophycin anticancer agents by an ester bond-forming non-ribosomal peptide synthetase module. (J Am Chem Soc. , 2011)
ACC
Q9KIZ9
PmId
[11564558] Epothilone biosynthesis: assembly of the methylthiazolylcarboxy starter unit on the EpoB subunit. (Chem Biol. , 2001)
[12911314] Oxidase domains in epothilone and bleomycin biosynthesis: thiazoline to thiazole oxidation during chain elongation. (Biochemistry. , 2003)

close this sectionPKS/NRPS Module

2 2-oxoisovaleric acid
3 L-cysteine
C60..354
A851..1268
KR1612..1809
PCP1946..2013
C2039..2335
A2523..2926
OX3008..3186
PCP3266..3335

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [HctE]
MNLVEFLQELSIKGWHIWSEGSQLRYDAPKEESTTSVLALLKQHKGEILQLLHDNPDILN
VYPLSYGQQAMWFLWKLAPGSCVYNVSVPVRICSEVDVTAWRQAFQALCQRHLMLSSTFT
KLGQVPIQQVDRHQEVDFLQVDASTWSKEELNQRVVEAHKHPFNLEKESGMRVRWFVRSF
QEHILLLTIHHIACDGWSLDIIFQELAKLYQAQQTNVPASLPALKYSYQDYVRAQRKILD
SPRGEILWQYWKQKLAGELPSLNLPTDKPRPPIQTYDGAAYHFSLSEKLSQQLIELAQKE
NVTLYTLLLAVFGVFLYRYTGQEDILVGSPTSGRNRAEEAPIVGFFANSVVMRMSASENL
SFKEFITKVQHTVLEAVNYQDYPFALLVERLLPNRDPSRSPIFQVFFLLQQMSEWRKLLS
GEMKTSSDWQGLKLEAFDRPTKECQFDFILEMIQVGSSLGGLIKYSTDLFEEKTIARMVE
HFQTLLQAIVTNPTANIDRLPLLTATERQQCLALGNNLERKQGQNKFIYQLFEDLFGYPG
EVSGKQTQLGDYTEVVPVAWPNDFSVYVLDSYGEPVPPGVTGEIYVGGGNLTESEINRSQ
QAPVSFVEHPELGSLLKTGERGYLRANGSLELQGFGQRWAWIKGHRVELQAIEKALLAIT
GVEDCYVIMRQRQLVAYVVTSKSFLSESLHNQLKTELPSYMLPSAYVPVSNLPLTGKGLI
DESALAQLEVIDSELVSRWEQQLRSLPEIEQVAVVVQPQVKTLSRLHISDLVPSPPRGTD
TDTHQVETDNLIDKGKQNLPQEVNQLAISEGEPLTEPEAQTLGEILQRAALENSTKGVVY
IQPDGTEFVQSYKNLLEDAQRILGGLRKLGLKPQDKVIFQLSANQNFISAFWGCILGGFI
PVPIAATGNLNKLQNSWQMLGKPLVISEEKLAPKLHQWAAELKLENFQIEAIEPLKDSEA
DRNWHESNSEELVLLLLTSGSTGMPKAVMHNHRSLLSRSAATVQTNSFSKEDISLNWFSL
DHVGGIVMFHLRDVYLGCQQIHAPTELVLQEPTRWLDWISHYRATITWAPNFAYGLIVQE
LENRQKTGSQQENHRGWDLSSMHFILNAGEAIVAKTVRGFLEVLGQYQLHDSAMHPAWGM
SETSSAVTFSSNFLLSSTTDEQKFVEVGSPVPGFAIRIVDNQNQIVKETMAGRVQVKGPS
VTSGYYQNTEANQDAFTEDGWFNTGDIGFLQQGCLTITGRQKDIIIINGLNYYSHEIEAT
IEEIEGVEVSYTAACAVRDGESDTDKLAIFFNPAKTARDREADLLKEIRLLVVARFGINP
DYLIPVEAEVIPKTAIGKIQRSQLKQRFESGEFNTILKRVDLLLLNVNTIPSWFYRKVWQ
AKVPVFNLSSQITTTLIFSDTLGLGTVLSEELEKHPQPCIQVSVGEKFTKISDNHYCLVP
DRAEHYQMLFKQLAQEKKTIGQIVCLWEYDQYRGEISHLEALEQSQKQGLFRLLFLVKAL
EQSRSEEQSVQLLWVSSYSQSIVPSDKIAYEKGTVLGLLKTIGQEMTWLNCRHIDLPVLE
VEVNEAYIRQELGNFAKETEVAYRDGKRLVCGIESVNLAEEPKQELPFITGGIYLISGGL
GGIGTEIASFLLKNYQARLLIVGRTSLPDQDTWQTHLDSGNALARKIQAYQQLQQLPGAV
IYEDVDICDYAQLQQILTTSLSKWGGQLDGIIHLAGILTEQLLVSQTLESFTAVLRPKFL
GTWALHKLLLEDNPQGLFIHFSSINGFFGGTTVGAYAAASSFMEAFCDYQQTYTSLQSYC
LSWSMWDEIGMSQGYQMKDLTHAKGYFSINKAQGMCSLLATLSRGQRHLFVGLDGSKANI
ERLTITSEPQNLQQLTAYFTSKVEQLPVSHLEALEVRDRFGRLSRCLWAQLAEMPLTETG
EIVREKLIGISTGIGLFEQTKPRNQVEHQLVEIFQQVLEVPVTSIHDNFFALGGNSLLAV
QVVSRIQQTFNQEVSLHILFESPTVGELGQTIIKENLLPGQKSDTSLPTLVPDPEQRYEP
FPLTDIQQAYWLGRNQAFDLGNVASHIYIEIDSENLDIERLNQAWQKLVDHYDMLRAVVL
PDGQQQVKQQVPFYQIQVFDLQNQPEPAVSDHLKAIREQMSHEILPSEQWPLFKLQATHF
NEKHYRLHLSFDALIADSWSLMLLGQYWLQLYRDPESSLPSLELSFRDYVLAKIGLDVTP
QYQRSQDYWFDRLSTLPPAPELPFAKQIVALEQPQFKRRSGRLNVVDWQRLKEKASQANI
TNSTVLLAAFADILTCWSKSSKFTINLTLFNRLPLHPQVNEVIGDFTSLTLLEVDNSKPT
PFIKRAQQLQKQLWQDLDHRYVSGVEVQRELRRLYGSYQAMGVVFTSVLGAGIESEEQLW
VNQLGQMVYSISQTPQVWLDHQVLEEQGELIFQWDIVEELFCEGVIDNMFQSYTDYLQHL
ATSESAWIDLYPQLLPKAQLQQLAQLNQINLPVPQQTLHGLFLQQVEKNYLELAVITPEH
CLTYGDLHQRARDIGHWLQQLGASRNSLVAVVMFKGWEQVVAVLAILMSGAAYVPIDPEL
PKERREFLLTQGEVQLVLTQESLLEQLAIPEGIECLSVDTFESIKNDSISFVPVHNPEDL
AYVIYTSGSTGLPKGVIIKHQAVVNTILDINQRFNVTANDRILAVSALNFDLSVYDIFGI
LAVGGTVVIPSAIDAKDPARWYELIVKHQVTLWNSVPALMQMLVEYLSGQLNQSHGPLRL
ALLSGDWIPLTLPEQIKDLWSQIQIVSLGGATEASIWSIYHPIEQITPVTKSIPYGKSLG
NQTVSVLNDLMQPTPVWVCGDLYIGGVGLASGYLLDEKKTNASFITHPVTHERLYKTGDL
GRYLPDGNIEFLGRCDFQVKINGYRVELGEVEAALSDHSTVKEVIVVVLGESEHKRLVAY
IVPSESSVDKAKLPEGYQPSQTVGVIQDPVEKIEFKLKQPGLRSPSPTKETISLPLSEFD
AAQKEAYLKRQSYRQFLREPLTLEELSQFLSCLLPIKLEEFPLPKYLYPSAGNLYPVQTY
LLIKPERVSGLSGGIYYYCPREHNLVLLNSLMKVDSRIYGGNQPIFEQSAFSLFLISKLS
AITPMYGELAEKFCLLEAGHMGQLLMSTAPDYQIGLCPIGGLEFNKLRDLFELESNQRLI
YSFICGKIDPVQTQQLFGKSSKDERSIPQQLNEHLQGKLPQYMLPNDYVLMDVFPLTANG
KVNRKALPAPEVSIKERNFLPPSTPIEEKLAGIWAKILELDLNQVSVNDDFFDIGGNSLL
ATKLISRIRQFFQVDLPLSDFFEEPTIAALVEHIEVLSWVGQDLQDSETNIEEIEL
selected fasta
>non-ribosomal peptide synthetase [HctE]
ATGAATTTAGTTGAGTTTTTACAAGAGCTTTCAATTAAAGGTTGGCATATCTGGAGTGAA
GGTTCGCAGCTACGCTACGATGCTCCCAAAGAAGAATCAACTACATCAGTATTGGCTCTA
CTGAAGCAACATAAGGGAGAGATTTTACAGTTACTGCATGACAACCCAGATATTCTCAAT
GTTTATCCCCTTTCCTATGGACAACAGGCAATGTGGTTTCTCTGGAAACTAGCACCTGGT
AGTTGTGTTTATAACGTGTCCGTACCTGTTCGTATTTGCTCTGAGGTGGATGTGACAGCT
TGGAGGCAAGCTTTTCAAGCTCTATGCCAACGTCACCTCATGCTGTCAAGCACATTTACT
AAGCTAGGTCAAGTACCCATTCAACAAGTGGATCGCCATCAAGAAGTGGACTTTTTGCAG
GTTGATGCCTCCACTTGGAGTAAAGAGGAATTAAATCAGAGAGTGGTTGAAGCTCACAAG
CATCCTTTTAACCTGGAAAAGGAATCGGGGATGCGCGTCAGGTGGTTTGTGCGGTCATTT
CAAGAGCATATCCTACTGCTGACAATACACCACATTGCCTGTGATGGCTGGTCTCTAGAC
ATCATCTTTCAGGAATTAGCTAAACTGTACCAAGCTCAACAGACCAATGTACCAGCATCT
CTTCCTGCTCTAAAGTATTCATATCAAGATTATGTTCGTGCTCAAAGGAAAATTTTGGAT
AGCCCCAGAGGAGAAATACTTTGGCAATACTGGAAACAAAAACTAGCGGGCGAATTACCA
AGCTTAAATCTACCCACAGACAAACCACGCCCGCCCATACAAACCTACGACGGGGCAGCC
TATCATTTTAGCTTATCTGAAAAACTCAGTCAGCAGCTTATAGAATTAGCTCAGAAGGAA
AATGTCACGCTCTACACCCTATTGTTGGCAGTCTTTGGTGTCTTTCTTTATCGTTACACA
GGTCAAGAGGATATTTTAGTTGGTTCTCCCACATCAGGTAGAAATAGAGCTGAAGAGGCT
CCTATTGTGGGCTTCTTTGCTAACTCGGTTGTTATGAGGATGTCGGCGTCGGAAAATCTA
AGTTTTAAGGAGTTTATCACTAAAGTTCAGCATACTGTATTAGAAGCAGTAAACTATCAA
GATTACCCTTTCGCATTGTTAGTAGAGCGATTGCTTCCAAATCGCGACCCTAGCCGTTCT
CCGATTTTTCAAGTTTTTTTCCTGCTACAGCAAATGTCTGAATGGCGAAAGCTGCTCTCT
GGCGAAATGAAGACGTCTTCGGATTGGCAAGGACTTAAGTTAGAAGCCTTTGACAGACCA
ACCAAGGAGTGTCAATTTGATTTCATACTAGAAATGATACAGGTCGGTTCCTCCCTGGGT
GGACTTATTAAGTACAGTACCGATCTATTTGAGGAAAAGACTATTGCCCGAATGGTGGAG
CATTTCCAGACATTATTACAAGCAATAGTAACAAACCCGACTGCTAACATAGATCGATTA
CCATTACTAACAGCAACTGAGCGGCAGCAGTGCCTAGCACTCGGAAATAACTTGGAGAGA
AAACAGGGGCAGAATAAATTTATCTATCAATTGTTTGAGGATTTATTTGGCTATCCAGGA
GAGGTGAGTGGCAAGCAAACTCAGTTGGGAGACTATACAGAAGTAGTGCCTGTGGCTTGG
CCAAATGATTTTTCAGTTTATGTGTTAGATTCCTATGGAGAACCAGTACCTCCAGGAGTA
ACAGGAGAGATTTATGTTGGAGGTGGCAATTTAACTGAGAGTGAGATAAATCGGAGCCAA
CAAGCCCCAGTTAGTTTTGTAGAGCATCCCGAACTTGGTAGTTTATTGAAAACTGGGGAA
CGGGGTTATCTTCGTGCCAATGGTTCTCTGGAATTGCAAGGATTTGGGCAACGTTGGGCT
TGGATAAAAGGGCATCGGGTGGAGTTGCAGGCTATAGAAAAAGCCTTATTGGCAATTACT
GGGGTGGAAGACTGCTATGTGATCATGCGACAACGACAACTAGTTGCTTATGTAGTGACC
TCAAAATCTTTCTTGTCAGAGTCTCTCCACAACCAGTTAAAGACCGAATTACCCAGCTAT
ATGCTGCCAAGTGCTTATGTACCAGTATCTAACCTGCCCTTAACAGGCAAAGGACTAATA
GATGAATCAGCGTTAGCCCAATTAGAGGTGATTGACTCCGAGTTAGTGTCACGTTGGGAA
CAACAGTTGCGATCGCTGCCAGAAATAGAGCAAGTAGCAGTGGTAGTTCAGCCACAAGTA
AAAACCCTGAGCAGATTACATATTTCTGATTTAGTACCCTCGCCCCCAAGGGGTACAGAT
ACAGATACTCATCAAGTTGAAACTGACAACTTGATCGACAAAGGTAAACAGAACTTGCCA
CAGGAAGTAAACCAACTAGCCATCAGCGAAGGAGAGCCTCTAACAGAGCCAGAGGCACAA
ACTTTAGGGGAGATACTGCAACGAGCAGCTTTAGAGAATTCGACTAAAGGTGTAGTATAC
ATCCAACCTGATGGAACTGAGTTCGTACAATCATATAAAAATTTATTAGAGGATGCCCAA
AGAATCTTGGGGGGGTTGAGAAAACTCGGTCTAAAGCCCCAAGACAAAGTAATTTTTCAA
CTATCAGCAAATCAAAACTTTATTAGTGCATTTTGGGGATGTATCCTGGGAGGATTTATA
CCTGTACCAATTGCGGCAACGGGCAACCTGAACAAGCTGCAAAATAGCTGGCAGATGCTA
GGAAAGCCATTGGTAATATCAGAGGAAAAGTTAGCTCCAAAACTTCATCAGTGGGCAGCA
GAATTAAAATTAGAAAACTTTCAGATAGAAGCGATAGAACCCTTAAAAGATTCAGAGGCA
GATCGCAATTGGCATGAATCAAACTCAGAGGAATTGGTGCTATTACTGCTAACTTCCGGC
AGTACAGGTATGCCCAAAGCGGTCATGCACAACCACCGTAGTTTGTTAAGCCGTAGTGCT
GCAACAGTTCAGACCAATAGCTTTAGCAAAGAAGATATTTCCTTAAATTGGTTTAGCCTC
GACCATGTTGGGGGAATAGTCATGTTCCATCTGAGGGACGTTTATTTGGGATGTCAGCAA
ATCCATGCTCCAACAGAACTGGTGTTGCAAGAACCAACAAGGTGGTTAGATTGGATTTCC
CACTATCGAGCCACAATTACTTGGGCCCCAAACTTTGCTTATGGGCTAATTGTGCAAGAA
CTAGAAAATCGACAAAAGACGGGCAGTCAACAAGAAAATCACCGAGGATGGGATTTGTCC
TCTATGCACTTTATTCTCAATGCTGGAGAGGCAATTGTTGCAAAAACCGTCAGGGGATTT
TTAGAAGTATTAGGCCAGTATCAGCTCCACGATAGCGCCATGCATCCAGCATGGGGCATG
TCAGAAACCTCAAGTGCGGTAACGTTTTCATCCAATTTTTTGCTGTCCTCAACTACAGAT
GAGCAAAAATTTGTCGAAGTTGGTTCCCCAGTGCCAGGATTTGCCATCAGAATAGTAGAC
AATCAAAACCAGATAGTGAAAGAGACAATGGCGGGTCGAGTACAAGTAAAAGGACCGTCT
GTCACATCTGGTTACTATCAAAATACAGAGGCAAACCAAGACGCTTTTACAGAAGATGGT
TGGTTTAATACTGGAGATATAGGCTTCCTGCAACAAGGGTGTTTAACAATAACCGGACGG
CAAAAAGACATTATCATCATTAACGGTCTCAACTACTACAGCCATGAAATTGAAGCCACA
ATAGAAGAAATAGAAGGTGTAGAAGTTTCTTATACTGCTGCTTGTGCGGTGAGAGATGGC
GAAAGCGATACAGACAAACTAGCCATATTTTTCAACCCAGCCAAAACCGCAAGGGATCGG
GAAGCAGATTTGTTAAAAGAAATTCGCTTACTGGTAGTGGCTCGTTTTGGGATTAATCCT
GATTATTTGATTCCTGTAGAAGCAGAGGTTATTCCCAAAACAGCGATCGGAAAAATTCAA
CGTTCTCAACTAAAACAGCGTTTTGAATCTGGTGAATTTAACACCATTCTCAAACGGGTA
GATTTGTTACTATTGAATGTCAATACTATCCCAAGCTGGTTTTACCGAAAGGTCTGGCAA
GCCAAAGTCCCTGTTTTTAATCTGTCTTCCCAGATAACTACAACCCTAATATTTAGCGAT
ACTTTAGGGCTAGGAACAGTCTTATCTGAGGAATTAGAAAAACATCCCCAGCCCTGTATC
CAAGTTTCTGTCGGTGAAAAATTTACCAAAATCAGTGACAATCATTATTGTCTTGTGCCC
GACCGAGCAGAACACTATCAGATGCTGTTTAAGCAATTGGCACAAGAAAAGAAAACGATT
GGCCAGATTGTCTGCCTGTGGGAATACGATCAATATAGAGGAGAAATTTCACACCTAGAA
GCGCTGGAGCAGTCACAAAAGCAAGGGTTGTTTCGTTTGCTTTTCTTAGTTAAAGCATTA
GAACAATCTCGGAGTGAAGAGCAGTCGGTGCAATTACTGTGGGTATCAAGTTACAGTCAG
TCGATAGTACCGAGTGATAAGATAGCCTATGAGAAAGGCACAGTTTTGGGCTTATTGAAA
ACCATTGGTCAAGAAATGACATGGTTGAACTGTCGTCACATCGATCTGCCAGTACTAGAG
GTTGAAGTCAATGAGGCATACATTCGGCAAGAACTGGGCAATTTTGCCAAAGAAACAGAA
GTAGCCTACAGAGACGGAAAACGCTTGGTTTGTGGAATCGAATCTGTAAATCTAGCTGAA
GAACCAAAGCAAGAATTACCATTCATAACAGGTGGTATCTACTTAATAAGTGGAGGGCTT
GGAGGTATTGGAACTGAAATTGCTAGTTTCCTACTTAAGAATTATCAAGCACGGTTGCTG
ATAGTTGGTCGCACTTCTCTACCCGATCAAGATACTTGGCAAACTCATTTAGATAGTGGA
AATGCACTGGCAAGGAAAATCCAAGCTTATCAACAATTGCAGCAACTACCAGGGGCAGTC
ATTTATGAAGATGTAGATATCTGCGATTATGCTCAGTTGCAGCAGATATTGACAACAAGT
TTATCCAAATGGGGAGGCCAGCTTGATGGGATTATCCATCTAGCAGGAATTTTAACCGAA
CAACTATTAGTATCCCAAACCCTAGAAAGTTTCACTGCCGTTCTTCGTCCCAAATTCCTT
GGGACTTGGGCCTTACATAAACTACTGCTGGAAGATAATCCTCAAGGTTTGTTTATTCAT
TTTTCTTCCATCAATGGCTTCTTTGGAGGTACAACTGTAGGTGCTTATGCTGCTGCCTCT
AGTTTTATGGAAGCGTTTTGCGATTACCAGCAGACCTATACTAGCCTGCAAAGCTACTGC
TTATCATGGAGTATGTGGGATGAAATCGGCATGAGTCAGGGCTACCAAATGAAAGACTTG
ACCCATGCTAAAGGGTACTTTTCGATTAATAAGGCACAAGGGATGTGCTCTTTATTAGCC
ACGTTGTCTCGTGGCCAACGTCATTTGTTTGTGGGTTTGGATGGGAGTAAAGCCAACATT
GAACGTTTAACTATTACCTCAGAACCTCAAAACCTACAGCAGTTAACTGCTTATTTCACC
TCCAAGGTAGAACAATTACCAGTGAGTCATTTAGAAGCGTTGGAAGTACGCGATCGCTTT
GGCAGACTCAGCCGTTGTCTGTGGGCACAACTTGCCGAGATGCCTCTAACTGAAACTGGA
GAAATTGTTCGAGAAAAGCTGATTGGAATTAGCACAGGTATTGGTCTTTTTGAACAAACC
AAACCACGCAACCAAGTAGAACATCAACTCGTTGAAATTTTTCAGCAGGTACTAGAAGTG
CCTGTTACTAGTATCCATGACAATTTCTTTGCTCTGGGCGGAAATTCTCTGCTAGCAGTG
CAAGTGGTTTCTCGTATACAGCAAACCTTTAATCAAGAGGTTTCTCTGCATATACTGTTT
GAATCACCTACAGTTGGTGAACTGGGGCAAACCATAATCAAAGAAAATCTCTTACCAGGG
CAAAAATCAGATACTAGTTTACCAACCCTTGTACCTGACCCAGAACAACGCTACGAACCA
TTCCCTCTAACTGATATTCAACAAGCTTATTGGCTAGGTCGCAATCAAGCCTTTGATTTA
GGTAATGTTGCTAGCCATATTTACATAGAGATCGATTCTGAAAACTTAGATATAGAACGC
TTAAACCAGGCTTGGCAGAAATTAGTTGACCACTATGATATGCTGCGAGCCGTAGTGTTA
CCCGACGGACAACAGCAAGTCAAACAACAAGTACCGTTCTATCAAATACAAGTTTTTGAT
TTGCAAAACCAGCCAGAACCAGCAGTTAGTGACCACCTCAAGGCAATTCGGGAGCAAATG
TCTCACGAAATATTACCCTCTGAGCAATGGCCATTGTTCAAGTTGCAGGCCACTCACTTC
AATGAAAAGCACTATCGCCTCCATCTGAGTTTTGATGCTTTAATTGCTGATAGCTGGAGC
CTAATGCTACTGGGGCAGTATTGGCTGCAACTGTATCGAGACCCAGAAAGTTCGCTACCT
TCATTGGAACTGTCATTTCGCGACTATGTGCTGGCTAAAATAGGGCTGGATGTTACACCA
CAGTATCAGCGTTCTCAAGATTACTGGTTCGATCGCTTGTCCACTCTCCCGCCAGCACCA
GAATTACCCTTTGCCAAGCAGATAGTTGCTCTGGAGCAACCGCAGTTTAAACGTCGCAGT
GGGCGATTAAATGTTGTTGATTGGCAGCGATTAAAAGAAAAGGCAAGTCAGGCAAATATA
ACTAATTCTACTGTTTTATTAGCTGCTTTTGCTGACATATTAACTTGTTGGAGCAAGAGT
TCTAAGTTTACCATTAACCTGACCCTGTTTAATCGCCTACCCTTACATCCCCAAGTTAAT
GAGGTGATTGGAGATTTCACATCCCTCACGCTCCTAGAAGTTGATAACTCAAAACCGACT
CCTTTTATTAAGCGTGCTCAACAGCTACAGAAACAACTGTGGCAAGATTTAGACCACCGT
TATGTCAGTGGTGTGGAAGTGCAGCGAGAATTGCGCCGCCTATATGGAAGTTATCAAGCT
ATGGGGGTTGTCTTTACCAGCGTTCTGGGGGCTGGTATCGAGTCGGAAGAACAATTGTGG
GTTAATCAGCTAGGACAAATGGTCTATAGCATTAGCCAAACCCCTCAAGTCTGGCTAGAC
CATCAAGTGCTTGAAGAACAAGGCGAATTAATATTTCAGTGGGATATAGTTGAAGAGCTT
TTCTGTGAAGGTGTTATTGATAATATGTTCCAGAGTTACACAGATTATCTGCAACACCTA
GCAACTTCAGAATCTGCTTGGATAGACCTGTACCCTCAACTGTTACCAAAAGCCCAACTC
CAACAACTTGCACAACTCAATCAGATAAATCTACCTGTTCCCCAACAAACCTTACACGGT
CTGTTTCTGCAGCAGGTGGAAAAAAATTATCTAGAATTAGCAGTGATTACCCCAGAGCAC
TGCTTAACCTATGGAGACTTACACCAACGCGCTCGCGACATCGGGCATTGGTTGCAACAA
CTGGGAGCTTCGCGCAATAGCTTAGTAGCTGTAGTAATGTTCAAGGGATGGGAACAAGTT
GTTGCAGTCTTGGCAATCTTGATGTCTGGTGCGGCCTATGTGCCTATTGACCCCGAACTC
CCCAAGGAGCGCAGAGAATTTTTACTTACCCAAGGGGAAGTACAGTTGGTTCTGACCCAA
GAATCTCTGTTAGAACAACTAGCAATACCAGAGGGAATTGAGTGTTTGTCTGTAGATACT
TTCGAGTCAATAAAAAATGATTCAATATCCTTCGTCCCCGTACATAATCCAGAAGATTTA
GCCTATGTAATTTATACGTCTGGCTCTACAGGTTTACCCAAAGGGGTGATCATTAAGCAT
CAAGCAGTAGTAAACACCATCCTCGACATCAACCAGCGATTCAATGTTACAGCTAATGAC
CGAATACTAGCTGTATCCGCGTTGAATTTTGACCTATCGGTATATGACATTTTTGGTATC
CTGGCTGTTGGAGGAACTGTGGTCATCCCATCTGCTATTGATGCTAAAGATCCTGCTCGT
TGGTACGAGTTAATTGTTAAACACCAAGTTACATTGTGGAACTCTGTACCCGCACTAATG
CAAATGTTAGTTGAGTACTTGTCTGGGCAGCTCAACCAGTCCCATGGCCCCCTACGATTA
GCATTGCTTAGTGGCGATTGGATACCACTAACTTTACCAGAGCAAATTAAAGATTTATGG
AGCCAGATCCAAATTGTCAGCTTAGGTGGTGCAACTGAAGCCTCAATTTGGTCAATTTAT
CACCCGATCGAACAAATTACCCCTGTAACGAAGAGCATTCCTTACGGTAAATCCCTTGGC
AATCAAACTGTTTCTGTCCTCAACGATCTAATGCAGCCTACTCCAGTCTGGGTATGTGGA
GATCTTTATATCGGAGGCGTTGGTTTGGCTTCTGGGTATTTATTAGATGAGAAAAAGACA
AACGCAAGTTTTATCACTCACCCAGTTACTCACGAACGATTGTACAAAACCGGTGATTTG
GGACGATATTTGCCCGATGGTAATATTGAATTTCTCGGTCGCTGTGATTTCCAAGTTAAA
ATCAATGGCTATCGCGTTGAATTGGGTGAAGTTGAGGCTGCATTAAGCGATCATTCTACT
GTCAAGGAGGTTATTGTTGTTGTTCTTGGCGAGTCGGAACACAAGCGTTTAGTCGCTTAT
ATTGTCCCCAGTGAGTCCTCTGTTGACAAAGCAAAGCTACCAGAAGGTTATCAACCTAGT
CAAACAGTAGGGGTAATACAAGACCCTGTGGAGAAAATTGAATTTAAACTCAAGCAACCA
GGATTGCGTTCACCATCTCCCACAAAAGAAACTATCAGTTTACCACTGTCAGAATTTGAT
GCAGCTCAAAAAGAAGCGTACCTCAAACGTCAGAGTTATCGGCAATTCTTGAGAGAACCG
CTGACGTTGGAGGAGTTGAGCCAGTTTTTAAGCTGTCTACTGCCAATCAAACTGGAGGAG
TTTCCCTTACCCAAATATCTTTATCCTTCGGCGGGAAATCTTTATCCTGTACAAACCTAT
TTGTTAATTAAACCGGAACGGGTTTCAGGATTATCAGGAGGGATTTATTACTATTGTCCC
CGGGAGCATAACTTAGTATTGCTCAATTCCTTGATGAAGGTTGACAGCAGGATTTACGGT
GGCAATCAACCGATTTTTGAGCAGTCTGCATTTTCTCTATTTTTGATTAGCAAACTCAGT
GCTATTACTCCGATGTATGGCGAACTAGCTGAAAAGTTCTGTTTGCTGGAGGCAGGGCAC
ATGGGACAGTTGTTGATGAGTACGGCTCCCGACTACCAAATAGGCCTTTGTCCCATTGGG
GGTCTGGAGTTTAACAAGTTACGAGATTTATTTGAGTTGGAATCGAATCAGCGTCTAATT
TATAGTTTTATTTGTGGTAAGATTGACCCAGTTCAAACCCAACAGTTATTCGGTAAATCT
TCAAAGGACGAGCGATCTATTCCACAACAACTAAACGAGCATTTACAAGGAAAATTACCC
CAGTATATGCTCCCCAATGATTATGTGTTAATGGATGTCTTTCCTTTAACTGCAAATGGG
AAAGTTAACCGCAAAGCTCTACCTGCTCCTGAGGTATCAATAAAAGAAAGAAATTTTCTG
CCCCCCAGTACCCCTATTGAGGAGAAGTTAGCTGGCATTTGGGCAAAAATATTAGAGTTA
GACTTAAACCAAGTTAGTGTTAATGATGATTTCTTTGACATTGGTGGCAATTCATTGCTT
GCTACTAAGCTAATCTCCAGAATTCGACAATTTTTCCAAGTCGACCTACCTCTATCTGAC
TTTTTTGAAGAACCTACAATTGCTGCTCTGGTTGAACACATTGAAGTTCTTAGTTGGGTG
GGACAAGATCTACAAGATTCAGAAACAAATATAGAGGAGATAGAATTATGA
[2] C60..354
[2] A851..1268
[2] 2-oxoisovaleric acid986..1149
[2] KR1612..1809
[2] PCP1946..2013
[3] C2039..2335
[3] A2523..2926
[3] L-cysteine2654..2800
[3] OX3008..3186
[3] PCP3266..3335
[2] C178..1062
[2] A2551..3804
[2] 2-oxoisovaleric acid2956..3447
[2] KR4834..5427
[2] PCP5836..6039
[3] C6115..7005
[3] A7567..8778
[3] L-cysteine7960..8400
[3] OX9022..9558
[3] PCP9796..10005

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000415 Nitroreductase-like (Domain)
 [3001-3189]  1.50000306971104e-22 SSF55469
SSF55469   Nitroreductase
 [3008-3186]  6.79999999999998e-18 PF00881
PF00881   Nitroreductase
 [3005-3191]  2.1e-17 G3DSA:3.40.109.10
G3DSA:3.40.109.10   G3DSA:3.40.109.10
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [554-667]  5e-16 PF00501 [851-1268]  2.99999999999998e-85 PF00501 [2523-2926]  4.40000000000003e-104 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [60-354]  1.5e-73 PF00668 [2039-2335]  9.40000000000003e-46 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1971-1986]  PS00012 [3293-3308]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1946-2013]  PS50075 [3266-3335]  PS50075
PS50075   ACP_DOMAIN
 [1939-2012]  4.6e-51 G3DSA:1.10.1200.10 [3256-3335]  4.6e-51 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1949-2011]  8.60000000000001e-13 PF00550 [3268-3334]  4.10000000000001e-18 PF00550
PF00550   PP-binding
 [1939-2055]  1.20000117458134e-18 SSF47336 [3259-3337]  8.40001703163685e-21 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [2523-2926]  3.49999999999995e-122 TIGR01733
TIGR01733   AA-adenyl-dom
IPR013624 Non-ribosomal peptide synthetase (Domain)
 [2359-2416]  1.5e-17 PF08415
PF08415   NRPS
IPR013968 Polyketide synthase, KR (Domain)
 [1612-1808]  5.69999999999998e-39 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [1610-1815]  3.3e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020051 SagB-type dehydrogenase domain (Domain)
 [3022-3187]  2.5e-25 TIGR03605
TIGR03605   Antibiot_sagB
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1947-2016]  1.6999992228405e-05 SM00823 [3267-3338]  1.29999924468179e-11 SM00823
SM00823   PKS_PP
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1612-1809]  7.79998304125571e-31 SM00822
SM00822   PKS_KR
IPR020845 AMP-binding, conserved site (Conserved_site)
 [975-986]  PS00455 [2643-2654]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit