close all open/close all

CDS information : Hecto_00060


close this sectionLocation

Organism
StrainJHB
Entry nameHectochlorin
Contig
Start / Stop / Direction24,086 / 35,923 / + [in whole cluster]
24,086 / 35,923 / + [in contig]
Location24086..35923 [in whole cluster]
24086..35923 [in contig]
TypeCDS
Length11,838 bp (3,945 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)HctF
GenehctF
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • nonribosomal peptide synthetase; C-A-KR-PCP-Cy-A-Ox-A-PCP-TE
Reference
ACC
PmId
[18001088] Cloning and biochemical characterization of the hectochlorin biosynthetic gene cluster from the marine cyanobacterium Lyngbya majuscula. (J Nat Prod. , 2007)
Related Reference
ACC
A4D936
NITE
Crypto_00040
PmId
[21823639] Chemoenzymatic synthesis of cryptophycin anticancer agents by an ester bond-forming non-ribosomal peptide synthetase module. (J Am Chem Soc. , 2011)
ACC
Q9KIZ9
PmId
[11564558] Epothilone biosynthesis: assembly of the methylthiazolylcarboxy starter unit on the EpoB subunit. (Chem Biol. , 2001)
[12911314] Oxidase domains in epothilone and bleomycin biosynthesis: thiazoline to thiazole oxidation during chain elongation. (Biochemistry. , 2003)

close this sectionPKS/NRPS Module

4 2-oxoisovaleric acid
5 L-cysteine
C76..374
A564..958
A1143..1560
KR1904..2101
PCP2238..2305
C2334..2630
A2818..3222
OX3304..3479
PCP3570..3637
TE3659..3922

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [HctF]
MKNQTIVKFLSQLRKLNIQFLDDGEKLRCQAPEGVLTPALSRQIAERKAEILAYLQQARQ
KTSSSPPAISVVSRDEKLPLSFAQERLWFFDQLDGSTAPYIEQGAMKLSGNLNILALQQA
FCEIVRRHEVFRTRFHSVNGIPMQVIVPDASLEISVVDWEHLPKTQQERQIKQYAQQQAK
IPFNLSEDLLLRVTLLQLSQQEFILLVALHHIVADVWSVGLLVQELSVLYQAYSQEKPSP
LPEPSIQYADFAAWQRQWLTAELQQKQLQYWQQQLADAPTLLRLPMDRSRPSVQSYRGNT
QTFAIDKQLTNQLRKLSQNTETTLFMTLLAAFAVLLFRYSAQDDILIGSPIANRNHSEIE
SLIGFFANTITLRTCLKGNPSFEQLLEQVRKVTLSAYTHQDVPFERVVETLQPERSLSYS
PLFQVVFILQDAPMESFELPGVTLKYLPEINPGTAKFDLVLSMEETEIGLIGTWEYSTDL
FEEQTIARMARHFQTLLSAIVANPTHKIEKLPLLTASDRQQLLAVGNNNDLEPVPDKCFH
QLFEEQVERSPDEVAVVHLDRQLTYRQLNEQANQLARYLQSWGIQPESPVCCLSTERSVE
MIVALLGILKAGGSYVLVDPSEPIQSLAKIPDQLLLVSLTQEKDLCHWLENKTKVVYLDS
EWEAIAQQSTENLNSNSTPENLAYVLGLETQSISVEHRAVVRRLNWLQSKVELSLGERVL
HQTSLGPESVLWEIFLPLMVGGCVVIAPTERFDSAASWQQLIAEKKISIANFLPSQLTAF
VGSLNLTAAGQLTHLRWLLCSGESLSHSEVEICSQYLNAHLLYAYTLPEIAGEVSCWQTQ
LGEHTEVAPVNLPTDFSVYVLDPYGEPVPPGVTGEVYVKGRDLTQSKLNQTKETPVSFVE
HPELGSLLKTGEWGCLRANGCLELQGFEQRWAWIKGHRVELQAIERALLAITGVEDCYIL
MRQRQLVAYVATSKSFLPESFHNQLKTQLPSYMLPSAYVPVSSLPLTGKGLIDESALAQL
EVIDSELVSRWEEQLRSLPEIEQVAVVVQPQVKTLSRLHISDLVPSPPRGTDTDTHQVET
DNLIDKGKQNLPQEVNQLAISEGEPLTEPEAQTLGEILQRAALENSTKGVVYIQPDGTEF
VQSYKNLLEDAQRILGGLRKLGLKPQDKVIFQLSANQNFISAFWGCILGGFIPVPIAATG
NLNKLQNSWQMLGKPLVISEEKLAPKLHQWAAELKLENFQIEAIEPLKDSEADRNWHESN
SEELVLLLLTSGSTGMPKAVMHNHRSLLSRSAATVQTNSFSKEDISLNWFSLDHVGGIVM
FHLRDVYLGCQQIHAPTELVLQEPTRWLDWISHYRATITWAPNFAYGLIVQELENRQKTG
SQQENHRGWDLSSMHFILNAGEAIVAKTVRGFLEVLGQYQLHDSAMHPAWGMSETSSAVT
FSSNFLLSSTTDEQKFVEVGSPVPGFAIRIVDNQNQIVKETMAGRVQVKGPSVTSGYYQN
TEANQDAFTEDGWFNTGDIGFLQQGCLTITGRQKDIIIINGLNYYSHEIEAAIEEIEGVE
VSYTAACAVREGDSDTDKLAIFFNPAKTARDREADLLKEIRLRVVARFGINPDYLIPVEA
EVIPKTAIGKIQRSQLKQRFESGEFNTILKRVDLLLLNVNTIPSWFYRKVWQAKVPVFNL
SSQITTTLIFSDTLGLGTVLSEELEKHPQPCIQVSVGEKFTKISDNHYCLVPDRAEHYQM
LFKQLAQEKKTIGQIVCLWEYDQYRGEISHLEALEQSQKQGLFRLLFLVKALEQSRSEEQ
SVQLLWVSSYSQSIVPSDKIAYEKGTVLGLLKTISQELTWLNCRHIDLPVAEVEVNKSYL
WQELGNFSKESEVAYRDGKRLVCGIESVNLAAQPKQQLPLKTGGIYLISGGLGGIGTKIA
SYLLKNYQARLLVVGRTSLPPQNTWSTQAAGENELAKKIRAYQQLQQLPGAIIYEAVDIC
DEAQLQQVVKTTISQWGGPLDGIIHLAGRFSEQLLASETPESFMGIVRPKVLGSWALHQL
LLKENQTGLFIHFSSVNGFFGGTTVGAYAAASSFQETFCDYQQTKTGVQSYCLSWSMWDE
IGMSQGYQMKELSRSKGFFAIDSKQGINCLLAALSHGQSHLLVGLDGTQPNIERWTFTSP
PQNRQQLTAYFTSQVKELPVSRLEQLEVGDRFGRLSRCLWAQLAQMPLRSSGEIDREKLR
GLDTGMGVLEQTKPRNQVESQLVEIFQQVLEVPVASIHDNFFALGGNSLQAVQVVSRIQQ
TLNQEVSLHVLFQAPSVAQLGSTLITSGEDHLLGGQELNVGLPTLVPDPEQRYEPFPLTD
IQQAYWLGRDQAFDLGNIASHVYFELDCENLNLERLNQAWQKLVDYHDMLRAVVLPDGQQ
QVKQQVPFYQIQVFDLQNQPEPAVSDHLKAIREQMSHEILPSEQWPLFKFCATQLDEKHY
HLHLSFDALIADGWSLMLLGQQWVQLYQDPESSLPSLELSFRDYVLAQIALEVTPQYQRS
QDYWFGRLSTLPPAPELPFTKQLVALEQPQFTRRTARLSAVDWQRLKDRASQANLTNSTV
LLAAFADVLTRWSKDPKFTINLTLFNRLPLHPQVNQLLGDFTSLTLLEVDNSEEVPFINR
AQRLQEQLWQDLDHRYVSGVAVQRELRRQYGSYQGMGVVFTSTLGMSSQSEKQFSVNQLG
QMVYSISQTPQVWLDHQVMEEQGALLFDWDTVEELFCEGVVEEMFNSYTNYLQHLATSES
AWMEINPQLLPPAQLQQLAQLNQSNVTIPQQTLHGLFELQVEQNPEKKAVIAPERCLSYG
ELYQRARDIGDRLQQLGASPNSLVAVVMFKGWEQVVAVLAILMSGAAYVPIDPELPQQRR
EYLLGQGSVKLVLTQEPLLEQLAIPEGIECLSVDTFESGNHDSSAFIPRHQPEDLAYVIY
TSGSTGLPKGVMIKHQAVVNTILDINQRFDVTADDRILALSALSFDLSVYDIFGLLAAGG
TLVMPSAAKTKDPAHWYELIVTHQLTLWNSVPALMQILVEYLCGQESNQSGNALRLALLS
GDWIPLALPEQIKQLWPQAEIISLGGATEASIWSIYYPIAQIPPTTKSIPYGKSLTNQSF
YVLNDLMHPTPVWVCGQLYIGGRGLASGYLLDDQKTRERFITHPVTEEQLYKTGDLGRYL
PDGNIEFIGRCDFQVKINGYRVELGEVEVALKENSTVKEAIVSAFGELENKRLVAYIVPS
QPSVDKAKVPEGYQPSQTEGIILDPVERIEFKLKQPGLRSPSPTKETISLPLSEFDAAQK
EAYLKRQSYRQFLREPLTLEELSQFLSCLLPIKLEEFPLPKYLYPSAGNLYPVQTYLLIK
PERVSGLSGGIYYYCPREHNLVLLNSLMKVDSRIYGSNQPIFDQSAFALFLINKLSAITP
MYGELAEKFCLLEAGHMGQLLMSTAPDYEMGLCPIGGLEFNKLRDLFELESNQSLIYSFV
GGKIDPVQTQQLFTEQPSKKPKSLPQQLREHLQQMLPSYMVPNDYVLLETLPLTSNGKID
RKSLPAPETVQSLQTQQQLQENFVPPRDLVELKLAQIWSNILDIPSVGVRDNFFDLGGNS
LVAIRLMTQIEQQFGRNLSLATLFEGQAIEQLATILREQSDSNFWSSLVPIQTGGQKQPF
FCVAGGGGNVLYFYHLASHLGLDQPLYALQSVGLDGESEPYTRIEDLAAHYVEAIKSVQP
KGPYLLGGHSFGGLVAFETAQQLQKQGDEVAKLFIIDMRAPAVDKPEPDSYQLDVDWDSA
GMLASIAGIFERMFGKNIGVSSEFLQPLSLEERLNYVNEQFQKVNLFPPGTGVKQIRGIL
RVGKANQQQEAYYVPRDIYPTQITLFRASEEAPMEVAASEDIHKILYDSRKNDPVWGWGE
FSAGEVELHSVPGDHLTIMAEPNVGVLAEKLRACLEKAQSANPID
selected fasta
>non-ribosomal peptide synthetase [HctF]
ATGAAGAATCAAACAATTGTGAAGTTCCTTTCTCAACTGCGTAAACTTAATATTCAATTT
TTGGATGATGGAGAAAAATTACGCTGTCAAGCTCCTGAAGGTGTGTTAACACCTGCACTA
TCGCGGCAGATAGCTGAACGCAAAGCAGAAATCTTGGCCTATCTGCAACAAGCTAGACAA
AAAACATCTAGTAGTCCTCCCGCCATTTCAGTTGTTTCTAGAGATGAAAAATTACCGCTC
TCCTTTGCTCAAGAAAGGCTGTGGTTCTTTGACCAACTTGATGGTTCCACGGCTCCTTAC
ATTGAGCAAGGAGCTATGAAACTCAGCGGTAATCTCAATATACTTGCTCTTCAGCAAGCC
TTTTGTGAAATTGTCCGACGCCATGAAGTATTCCGAACCCGCTTCCATTCGGTCAATGGC
ATACCGATGCAGGTGATTGTTCCCGATGCTTCTTTGGAAATATCAGTAGTAGATTGGGAG
CATTTACCAAAAACACAACAGGAAAGGCAAATAAAACAATATGCCCAGCAACAAGCAAAA
ATACCATTTAACCTGTCTGAGGATTTACTCTTACGAGTAACTTTGTTGCAATTATCACAG
CAGGAATTTATATTGCTGGTTGCCTTGCATCACATTGTCGCTGATGTTTGGTCAGTTGGA
TTGTTGGTTCAAGAATTATCTGTACTATATCAAGCCTACAGTCAGGAAAAACCCTCCCCT
TTGCCTGAACCATCTATCCAGTACGCTGATTTTGCTGCTTGGCAAAGGCAATGGTTAACT
GCGGAATTACAACAGAAGCAACTGCAATACTGGCAACAGCAATTAGCTGATGCTCCTACT
TTGCTGCGGTTGCCGATGGATAGATCGAGACCATCAGTGCAAAGCTATCGTGGTAATACT
CAGACTTTTGCAATTGACAAACAATTAACCAATCAACTGCGAAAACTTAGTCAAAACACC
GAAACCACCCTTTTTATGACGTTGTTGGCAGCGTTTGCTGTGCTGCTGTTTCGTTATAGC
GCTCAGGACGATATTTTGATTGGCTCGCCAATTGCAAACCGTAACCATTCAGAAATCGAA
TCCCTTATTGGCTTTTTTGCCAATACTATAACCTTGAGAACTTGCCTAAAAGGCAATCCA
AGTTTTGAACAGTTACTCGAGCAAGTGCGAAAAGTAACATTGTCAGCCTATACCCATCAG
GATGTACCCTTTGAGCGAGTAGTAGAAACCTTGCAACCAGAGCGTTCTCTGAGTTACTCA
CCTCTATTCCAGGTGGTATTTATATTACAGGATGCTCCGATGGAATCTTTCGAATTGCCT
GGTGTCACCCTGAAATATTTGCCAGAGATAAATCCGGGAACAGCAAAGTTTGATTTGGTC
TTATCAATGGAGGAGACAGAAATCGGACTTATAGGAACATGGGAGTATAGTACCGATCTA
TTTGAGGAACAAACAATTGCCAGGATGGCAAGGCATTTCCAGACGTTATTGTCTGCGATT
GTGGCGAACCCGACTCACAAAATAGAGAAACTACCGCTGCTGACAGCTAGCGATCGCCAG
CAATTACTAGCAGTAGGCAATAACAACGATCTAGAGCCAGTGCCAGACAAATGCTTCCAT
CAATTGTTTGAGGAACAAGTGGAACGCTCACCAGACGAGGTAGCCGTGGTACACCTCGAT
AGGCAGTTAACCTATCGGCAATTGAATGAGCAGGCTAATCAGTTAGCGCGTTATCTACAA
AGTTGGGGGATTCAACCAGAATCACCGGTCTGTTGTTTGAGTACAGAGCGGTCAGTAGAG
ATGATAGTGGCATTGTTAGGAATTCTCAAGGCGGGAGGATCCTATGTGCTAGTAGACCCA
AGCGAGCCAATCCAAAGCTTAGCTAAGATTCCAGATCAGTTACTATTAGTCAGTTTGACT
CAAGAAAAAGATCTGTGCCATTGGTTAGAAAACAAGACAAAGGTAGTGTATCTGGACTCG
GAATGGGAGGCGATCGCTCAACAAAGTACAGAAAACCTGAACAGTAACAGTACTCCAGAA
AATCTGGCTTATGTACTTGGCTTGGAAACTCAAAGCATTTCTGTAGAACATCGAGCAGTG
GTTCGTCGTCTTAACTGGCTGCAAAGCAAAGTCGAACTTTCTCTGGGAGAAAGGGTGTTG
CATCAAACTTCTCTAGGACCAGAAAGTGTGCTATGGGAAATCTTTTTGCCTTTGATGGTA
GGTGGTTGTGTAGTAATTGCACCAACAGAAAGATTCGACAGTGCCGCGTCTTGGCAGCAG
TTGATTGCAGAGAAAAAAATAAGTATAGCGAACTTTCTACCTTCGCAACTAACAGCCTTT
GTTGGTAGCTTAAATTTGACCGCAGCGGGGCAATTAACTCACTTACGTTGGCTGTTGTGT
TCAGGTGAATCGCTATCCCACTCGGAGGTGGAAATTTGCAGTCAATATTTGAACGCTCAT
TTATTATATGCGTACACTCTCCCAGAAATAGCAGGAGAGGTGAGTTGCTGGCAAACCCAA
TTGGGAGAGCATACAGAAGTAGCGCCTGTAAATCTTCCGACTGATTTTTCAGTTTATGTT
TTAGATCCCTATGGAGAACCAGTACCTCCAGGGGTAACAGGAGAGGTTTATGTAAAAGGG
CGCGATTTAACACAGAGTAAGTTAAATCAGACAAAAGAAACACCAGTTAGTTTTGTAGAG
CATCCCGAACTTGGTAGTTTATTGAAAACTGGGGAATGGGGTTGCCTTCGTGCCAATGGT
TGTCTGGAATTGCAAGGATTTGAGCAACGTTGGGCTTGGATTAAAGGGCATCGGGTGGAG
TTGCAGGCTATAGAAAGAGCCTTATTGGCAATTACTGGGGTGGAAGACTGTTATATATTG
ATGCGACAAAGGCAATTAGTTGCATATGTAGCGACCTCAAAATCTTTCTTACCAGAGTCT
TTCCACAATCAGTTAAAGACCCAATTGCCCAGCTATATGCTGCCAAGTGCCTATGTACCA
GTATCTAGCTTGCCATTAACAGGCAAAGGACTAATAGATGAATCAGCGTTAGCCCAATTG
GAGGTGATTGACTCCGAGTTAGTGTCACGTTGGGAAGAACAGTTGCGATCGCTGCCAGAA
ATAGAGCAAGTAGCAGTGGTAGTTCAGCCACAAGTAAAAACCCTGAGCAGATTACATATT
TCTGATTTAGTACCCTCGCCCCCAAGGGGTACAGATACAGATACTCATCAAGTTGAAACT
GACAACTTGATCGACAAAGGTAAACAGAACTTGCCACAGGAAGTAAACCAACTAGCCATC
AGCGAAGGAGAGCCTCTAACAGAGCCAGAGGCACAAACTTTAGGGGAGATACTGCAACGA
GCAGCCCTAGAGAATTCGACTAAAGGTGTAGTATACATCCAACCTGATGGAACTGAGTTC
GTACAATCATATAAAAATTTATTAGAGGATGCCCAAAGAATCTTGGGGGGGTTGAGAAAA
CTCGGTCTAAAGCCCCAAGACAAAGTAATTTTTCAACTATCAGCAAATCAAAACTTTATT
AGTGCATTTTGGGGATGTATCCTGGGAGGATTTATACCTGTACCAATTGCGGCAACGGGC
AACCTGAACAAGCTGCAAAATAGCTGGCAGATGCTAGGAAAGCCATTGGTAATATCAGAG
GAAAAGTTAGCTCCAAAACTTCATCAGTGGGCAGCAGAATTAAAATTAGAAAACTTTCAG
ATAGAAGCGATAGAACCCTTAAAAGATTCAGAGGCAGATCGCAATTGGCATGAATCAAAC
TCAGAGGAATTGGTGCTATTACTGCTAACTTCCGGCAGTACAGGTATGCCCAAAGCGGTC
ATGCACAACCACCGTAGTTTGTTAAGCCGTAGTGCTGCAACAGTTCAGACCAATAGCTTT
AGCAAAGAAGATATTTCCTTAAATTGGTTTAGCCTCGACCATGTTGGGGGAATAGTCATG
TTCCATCTGAGGGACGTTTATTTGGGATGTCAGCAAATCCATGCTCCAACAGAACTGGTG
TTGCAAGAACCAACAAGGTGGTTAGATTGGATTTCCCACTATCGAGCCACAATTACTTGG
GCCCCAAACTTTGCTTATGGGCTAATTGTGCAAGAACTAGAAAATCGACAAAAGACGGGC
AGTCAACAAGAAAATCACCGAGGATGGGATTTGTCCTCTATGCACTTTATTCTCAATGCT
GGAGAGGCAATTGTTGCAAAAACCGTCAGGGGATTTTTAGAAGTATTAGGCCAGTATCAG
CTCCACGATAGCGCCATGCATCCAGCATGGGGCATGTCAGAAACCTCAAGTGCGGTAACG
TTTTCATCCAATTTTTTGCTGTCCTCAACTACAGATGAGCAAAAATTTGTCGAAGTTGGT
TCCCCAGTGCCAGGATTTGCCATCAGAATAGTAGACAATCAAAACCAGATAGTGAAAGAG
ACAATGGCGGGTCGAGTACAAGTAAAAGGACCGTCTGTCACATCTGGTTACTATCAAAAT
ACAGAAGCCAACCAAGACGCTTTTACAGAAGATGGTTGGTTTAATACTGGAGATATAGGC
TTCCTGCAACAAGGGTGTTTAACAATAACCGGACGGCAAAAAGACATTATCATCATTAAC
GGTCTAAATTACTATAGCCATGAAATTGAAGCAGCAATAGAAGAAATAGAAGGTGTAGAA
GTTTCTTATACTGCTGCTTGTGCGGTGAGAGAGGGTGACAGTGATACAGACAAACTAGCC
ATATTTTTCAACCCAGCCAAAACCGCAAGGGATCGGGAAGCAGATTTGTTAAAGGAAATT
CGCTTACGAGTAGTGGCTCGTTTTGGGATTAATCCTGATTATTTGATTCCTGTAGAAGCA
GAGGTTATTCCCAAAACAGCGATCGGAAAAATTCAACGTTCTCAACTAAAACAGCGTTTT
GAATCTGGTGAATTTAACACCATTCTCAAACGGGTAGATTTGTTACTATTGAATGTCAAT
ACTATCCCAAGCTGGTTTTACCGAAAGGTCTGGCAAGCCAAAGTCCCTGTTTTTAATCTG
TCTTCCCAGATAACTACAACCCTAATATTTAGCGATACTTTAGGGCTAGGAACAGTCTTA
TCTGAGGAATTAGAAAAACATCCCCAGCCCTGTATCCAAGTTTCTGTCGGTGAAAAATTT
ACCAAAATCAGTGACAATCATTATTGTCTTGTGCCCGACCGAGCAGAACACTATCAGATG
CTGTTTAAGCAATTGGCACAAGAAAAGAAAACGATTGGCCAGATTGTCTGCCTGTGGGAA
TACGATCAATATAGAGGAGAAATTTCACACCTAGAAGCGCTGGAGCAGTCACAAAAGCAA
GGGTTGTTTCGTTTGCTTTTCTTAGTTAAAGCATTAGAACAATCTCGGAGTGAAGAGCAG
TCGGTGCAATTACTGTGGGTATCAAGTTACAGTCAGTCGATAGTACCGAGTGATAAGATA
GCCTATGAGAAAGGCACAGTTTTGGGTCTATTGAAAACAATTAGCCAAGAACTGACATGG
TTGAACTGTCGTCACATCGATCTGCCTGTAGCAGAGGTTGAAGTCAATAAGTCCTACCTT
TGGCAAGAACTGGGGAATTTTTCCAAAGAATCAGAAGTCGCCTACAGAGACGGAAAACGC
TTGGTTTGTGGCATCGAATCTGTAAATCTAGCCGCACAGCCGAAACAGCAATTGCCCTTG
AAAACAGGGGGGATTTACTTAATAAGTGGAGGCCTGGGAGGGATTGGAACAAAAATCGCC
AGTTACCTGCTCAAAAATTACCAAGCGCGATTGCTGGTAGTGGGTCGGACGTCATTACCC
CCTCAAAATACTTGGTCAACTCAGGCAGCAGGTGAAAATGAACTAGCCAAGAAAATTAGA
GCTTATCAACAGTTGCAGCAACTACCAGGAGCCATCATTTATGAGGCTGTAGATATCTGC
GATGAGGCTCAGTTGCAACAGGTAGTAAAAACAACTATATCCCAATGGGGAGGGCCGCTG
GATGGAATTATCCATTTGGCAGGAAGGTTCAGCGAACAACTACTAGCCTCTGAGACCCCA
GAGAGTTTCATGGGGATTGTTCGTCCCAAAGTCTTAGGCAGTTGGGCATTACATCAACTA
CTGCTCAAAGAGAATCAAACAGGTTTGTTTATCCATTTTTCTTCAGTCAATGGCTTCTTT
GGAGGCACAACGGTTGGTGCTTATGCCGCAGCATCCAGTTTCCAAGAAACGTTTTGTGAT
TACCAGCAGACAAAAACGGGTGTGCAAAGCTACTGCTTATCCTGGAGCATGTGGGATGAA
ATCGGCATGAGTCAGGGCTATCAAATGAAAGAATTGAGCCGCTCCAAAGGTTTCTTTGCC
ATAGACAGCAAACAAGGAATCAACTGTTTATTAGCAGCCTTGTCTCATGGTCAAAGCCAT
TTGCTAGTGGGACTCGATGGTACTCAACCTAATATCGAACGTTGGACTTTTACCTCACCA
CCTCAAAACCGACAACAGTTGACAGCTTATTTCACATCCCAGGTAAAAGAATTACCAGTC
AGTCGTTTAGAACAGTTGGAAGTAGGCGATCGCTTTGGTAGACTCAGCCGTTGTCTGTGG
GCACAACTAGCACAGATGCCTCTAAGGTCGTCAGGAGAAATTGATCGAGAGAAACTGAGG
GGACTGGACACGGGGATGGGTGTTTTGGAACAAACAAAACCACGCAACCAAGTAGAAAGC
CAACTGGTTGAAATTTTTCAGCAAGTCCTGGAAGTGCCCGTTGCTAGTATCCATGACAAC
TTCTTTGCTCTGGGAGGAAATTCTCTACAAGCAGTGCAAGTAGTGTCCCGCATACAGCAG
ACCTTGAACCAGGAGGTCTCCCTGCACGTATTGTTTCAAGCTCCCAGCGTCGCCCAACTA
GGGTCAACCCTGATCACCAGCGGTGAGGACCATCTGTTAGGGGGGCAAGAATTGAATGTG
GGTTTACCAACCCTTGTACCCGACCCAGAACAACGCTACGAACCATTCCCTCTGACCGAT
ATTCAACAAGCCTATTGGCTAGGCCGGGATCAAGCCTTTGACTTAGGTAATATTGCTAGC
CATGTTTACTTTGAACTCGATTGTGAAAACTTAAATCTAGAACGGTTAAACCAGGCGTGG
CAGAAATTAGTTGACTACCATGATATGCTGCGAGCTGTAGTGTTACCCGACGGACAACAG
CAAGTTAAACAACAAGTACCGTTCTATCAAATACAAGTTTTTGATTTGCAAAACCAGCCA
GAACCAGCAGTTAGTGACCACCTCAAGGCGATTCGGGAGCAAATGTCTCATGAAATATTA
CCATCGGAGCAATGGCCGTTGTTCAAGTTTTGCGCCACGCAGTTAGACGAAAAGCATTAT
CACCTGCATCTGAGTTTTGATGCTTTAATTGCTGATGGGTGGAGCCTCATGCTTCTGGGA
CAACAGTGGGTGCAACTGTATCAAGACCCAGAAAGTTCCCTGCCTTCCTTGGAACTCTCA
TTTCGCGACTATGTGCTGGCTCAAATCGCCCTGGAGGTCACACCACAGTACCAGCGCTCC
CAAGATTACTGGTTCGGGCGTTTGTCAACCCTACCACCAGCGCCAGAATTACCCTTTACC
AAGCAGCTAGTCGCCCTAGAGCAACCCCAGTTTACACGTCGCACCGCACGATTGAGCGCT
GTTGATTGGCAGCGATTAAAAGACAGGGCAAGTCAAGCGAATTTGACGAATTCTACGGTG
TTATTAGCTGCGTTTGCGGACGTATTAACTCGTTGGAGCAAAGACCCCAAGTTTACCATT
AATCTCACCCTATTTAATCGCTTACCTTTACATCCTCAAGTCAATCAGCTGCTCGGAGAC
TTTACATCCCTCACCCTATTGGAAGTTGATAACTCCGAGGAGGTTCCCTTTATTAACCGC
GCTCAACGGCTACAGGAGCAATTGTGGCAAGATTTAGACCACCGTTATGTTAGCGGTGTG
GCGGTGCAGCGAGAACTACGACGCCAGTATGGGAGCTATCAAGGGATGGGGGTCGTTTTT
ACTAGCACCTTAGGTATGAGTTCTCAATCGGAAAAACAATTTTCCGTCAATCAGCTAGGA
CAGATGGTCTATAGTATCAGCCAAACTCCTCAAGTTTGGTTAGACCATCAAGTTATGGAA
GAACAAGGAGCCTTGTTGTTTGACTGGGATACCGTTGAAGAACTGTTCTGTGAAGGTGTT
GTTGAGGAGATGTTTAACAGTTACACCAATTACCTGCAACACCTCGCCACATCCGAATCC
GCTTGGATGGAAATCAACCCGCAACTGTTACCACCAGCCCAACTCCAACAGCTGGCACAA
CTCAACCAGAGCAATGTCACTATTCCCCAGCAGACTTTACACGGTCTGTTTGAGTTGCAG
GTGGAACAAAACCCTGAAAAAAAGGCAGTGATTGCCCCAGAGCGCTGCCTGAGCTATGGA
GAATTATACCAACGCGCCCGGGACATCGGGGATCGGTTGCAACAACTGGGAGCTTCCCCC
AATAGCTTGGTGGCTGTAGTGATGTTCAAAGGATGGGAACAAGTGGTTGCGGTCTTAGCC
ATCTTGATGTCTGGTGCTGCCTATGTCCCCATTGACCCCGAACTCCCCCAACAACGAAGA
GAATATTTACTAGGCCAAGGGTCGGTGAAGCTAGTTTTGACCCAAGAACCCCTGTTAGAA
CAACTAGCAATACCAGAAGGCATTGAGTGTTTGTCTGTAGATACTTTCGAGTCTGGAAAC
CATGATTCTAGCGCCTTCATCCCCAGGCATCAGCCTGAAGATTTAGCCTATGTAATTTAT
ACCTCTGGTTCTACAGGTTTACCCAAAGGGGTCATGATTAAACATCAAGCAGTGGTAAAT
ACCATCCTCGATATCAATCAGCGCTTCGATGTGACAGCCGATGACCGAATACTAGCATTG
TCGGCTTTGAGTTTTGACCTGTCGGTCTATGATATCTTTGGGCTGTTGGCGGCTGGAGGG
ACTCTGGTCATGCCATCGGCGGCCAAAACCAAAGACCCCGCACACTGGTATGAGTTAATT
GTTACACACCAACTCACCCTCTGGAACTCCGTTCCCGCACTGATGCAAATATTGGTTGAG
TACTTGTGTGGGCAGGAGAGCAACCAGTCTGGTAATGCGCTGCGATTAGCATTACTCAGT
GGCGATTGGATACCACTAGCGTTACCAGAGCAAATTAAACAGTTGTGGCCCCAGGCCGAA
ATCATTAGCTTAGGTGGTGCAACAGAAGCCTCAATTTGGTCAATTTATTATCCGATCGCA
CAAATTCCACCTACAACTAAGAGCATTCCTTACGGTAAATCCCTGACCAATCAGAGTTTT
TATGTGCTAAATGACCTGATGCATCCTACTCCAGTCTGGGTCTGCGGGCAACTCTATATC
GGAGGGAGGGGACTGGCTTCTGGTTACTTATTAGATGACCAAAAGACTCGGGAGCGTTTT
ATTACTCACCCAGTAACTGAGGAGCAGTTATACAAAACAGGGGACTTGGGACGATATTTG
CCCGATGGTAACATTGAGTTTATCGGTCGCTGTGATTTCCAGGTGAAAATCAATGGCTAT
CGCGTTGAATTGGGTGAAGTTGAGGTCGCCTTAAAGGAAAACTCGACGGTCAAGGAAGCG
ATTGTCAGTGCCTTTGGTGAGTTGGAAAATAAGCGTTTAGTTGCTTATATTGTCCCCAGC
CAGCCATCGGTGGACAAAGCCAAGGTACCGGAAGGTTATCAACCGAGTCAAACAGAAGGG
ATCATACTCGACCCTGTGGAGAGAATTGAATTTAAACTCAAGCAACCAGGATTGCGTTCA
CCATCTCCCACAAAAGAAACTATCAGTTTACCACTGTCAGAATTTGATGCAGCTCAAAAA
GAAGCGTACCTCAAACGTCAGAGTTATCGGCAATTCTTGAGAGAACCGCTGACGTTGGAG
GAGTTGAGCCAGTTTTTAAGCTGTCTACTGCCAATCAAACTGGAGGAGTTTCCCTTACCC
AAATATCTTTATCCTTCGGCGGGAAATCTTTATCCTGTACAAACCTATTTGTTAATTAAA
CCGGAACGGGTTTCAGGATTATCAGGAGGGATTTATTACTATTGTCCCCGGGAGCATAAT
TTAGTATTGCTCAATTCCTTGATGAAGGTTGACAGCAGGATTTACGGTAGCAATCAACCG
ATTTTTGACCAGTCGGCCTTTGCCCTGTTTTTGATTAACAAACTCAGTGCCATTACTCCG
ATGTATGGCGAACTGGCGGAAAAGTTCTGTTTACTGGAGGCAGGGCACATGGGGCAGTTG
TTGATGAGTACGGCTCCCGACTACGAAATGGGTCTTTGTCCCATTGGGGGTCTGGAGTTT
AACAAGTTACGAGATTTATTTGAGTTGGAATCAAATCAGTCTCTAATTTATAGTTTTGTG
GGGGGCAAGATCGACCCAGTTCAAACCCAACAGTTGTTTACAGAGCAACCTTCAAAGAAA
CCGAAATCTCTGCCACAACAACTCCGGGAGCATTTACAACAGATGTTGCCCAGCTATATG
GTTCCCAATGATTATGTGCTGCTAGAGACTCTACCTTTGACCTCTAATGGCAAGATTGAC
CGCAAGTCCCTACCAGCTCCTGAGACAGTCCAATCGCTGCAAACTCAACAACAATTGCAA
GAGAATTTTGTCCCTCCTCGCGATCTAGTGGAACTCAAGTTGGCTCAAATTTGGTCAAAC
ATTCTTGATATTCCCTCCGTAGGAGTTCGAGACAACTTCTTCGATCTTGGTGGTAATTCC
CTTGTCGCTATTCGCCTAATGACCCAGATTGAGCAACAGTTTGGCAGAAATCTATCTTTG
GCAACTTTATTCGAAGGTCAGGCCATTGAACAATTGGCAACTATTCTCCGCGAGCAATCA
GATTCAAATTTTTGGTCTTCTCTTGTACCAATACAAACTGGAGGTCAGAAACAACCTTTC
TTTTGTGTAGCTGGAGGTGGTGGTAATGTTCTTTACTTTTATCATTTGGCGAGCCATTTA
GGTTTAGACCAACCATTATATGCTCTGCAATCTGTTGGACTTGATGGAGAATCAGAGCCT
TATACCCGAATTGAGGACTTAGCTGCCCATTACGTTGAAGCCATAAAATCCGTTCAACCC
AAAGGACCCTATTTGTTGGGAGGTCATTCCTTTGGCGGTTTAGTAGCTTTTGAAACTGCA
CAGCAGCTTCAAAAGCAGGGGGATGAGGTCGCCAAACTGTTCATTATCGATATGCGTGCG
CCAGCTGTGGATAAACCAGAACCTGACTCCTATCAATTAGATGTAGATTGGGATAGCGCA
GGCATGCTCGCCAGTATTGCTGGAATATTTGAGCGTATGTTTGGAAAAAATATTGGGGTC
TCCTCTGAATTTCTCCAACCACTGTCTTTGGAGGAGCGGTTGAACTATGTTAACGAGCAG
TTTCAAAAGGTCAATCTTTTCCCCCCTGGAACTGGAGTTAAACAAATTCGCGGTATTCTT
CGAGTTGGGAAAGCGAATCAACAACAAGAAGCTTATTACGTTCCACGGGACATTTATCCA
ACTCAAATTACTCTGTTTCGAGCTAGCGAGGAAGCGCCTATGGAGGTTGCCGCTAGTGAG
GATATCCATAAGATTCTTTACGATAGTAGAAAAAACGATCCGGTGTGGGGCTGGGGTGAG
TTTTCTGCTGGAGAAGTGGAACTTCATAGTGTTCCAGGCGACCATCTTACAATCATGGCG
GAGCCAAACGTTGGTGTTTTAGCTGAAAAGTTGAGAGCTTGCTTAGAAAAAGCACAATCA
GCCAACCCTATTGATTAA
[4] C76..374
[4] A564..958
[4] A1143..1560
[4] 2-oxoisovaleric acid1278..1441
[4] KR1904..2101
[4] PCP2238..2305
[5] C2334..2630
[5] A2818..3222
[5] L-cysteine2949..3096
[5] OX3304..3479
[5] PCP3570..3637
[5] TE3659..3922
[4] C226..1122
[4] A1690..2874
[4] A3427..4680
[4] 2-oxoisovaleric acid3832..4323
[4] KR5710..6303
[4] PCP6712..6915
[5] C7000..7890
[5] A8452..9666
[5] L-cysteine8845..9288
[5] OX9910..10437
[5] PCP10708..10911
[5] TE10975..11766

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000415 Nitroreductase-like (Domain)
 [3297-3485]  1.60000240695997e-19 SSF55469
SSF55469   Nitroreductase
 [3301-3487]  3.90000000000001e-16 G3DSA:3.40.109.10
G3DSA:3.40.109.10   G3DSA:3.40.109.10
 [3304-3479]  1.6e-16 PF00881
PF00881   Nitroreductase
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [564-958]  1.40000000000001e-53 PF00501 [1143-1560]  1.20000000000001e-85 PF00501 [2818-3222]  3.99999999999998e-102 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [3659-3922]  3.40000000000004e-37 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [76-374]  1.29999999999998e-78 PF00668 [2334-2630]  2.70000000000002e-50 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [2263-2278]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2231-2304]  2.4e-47 G3DSA:1.10.1200.10 [3560-3641]  2.4e-47 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2231-2306]  4.40000933643891e-17 SSF47336 [3563-3638]  1.99999636034521e-19 SSF47336
SSF47336   ACP_like
 [2238-2305]  PS50075 [3570-3637]  PS50075
PS50075   ACP_DOMAIN
 [2241-2301]  1.5e-11 PF00550 [3573-3634]  7.5e-12 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [2818-3222]  5.59999999999999e-123 TIGR01733
TIGR01733   AA-adenyl-dom
IPR013624 Non-ribosomal peptide synthetase (Domain)
 [2654-2711]  1e-19 PF08415
PF08415   NRPS
IPR013968 Polyketide synthase, KR (Domain)
 [1904-2100]  8.89999999999994e-38 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [1902-2107]  2.3e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020051 SagB-type dehydrogenase domain (Domain)
 [3318-3481]  8.49999999999995e-25 TIGR03605
TIGR03605   Antibiot_sagB
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1904-2101]  9.30000048475975e-30 SM00822
SM00822   PKS_KR
IPR020845 AMP-binding, conserved site (Conserved_site)
 [1267-1278]  PS00455 [2938-2949]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit