close all open/close all
Hecto_00070 Hecto_00070   last last

CDS information : Hecto_00080


close this sectionLocation

Organism
StrainJHB
Entry nameHectochlorin
Contig
Start / Stop / Direction38,547 / 39,881 / + [in whole cluster]
38,547 / 39,881 / + [in contig]
Location38547..39881 [in whole cluster]
38547..39881 [in contig]
TypeCDS
Length1,335 bp (444 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)HctH
GenehctH
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • cytochrome P450 monooxygenase
Reference
ACC
PmId
[18001088] Cloning and biochemical characterization of the hectochlorin biosynthetic gene cluster from the marine cyanobacterium Lyngbya majuscula. (J Nat Prod. , 2007)
Family/Domain
FD
IPR001128

close this sectionSequence

selected fasta
>putative cytochrome P450 [HctH]
MMKFPDGPKTPALLQSINLIVNPLNYLEDCAKRYGDIFTIRFLNYPPTVLVSHPQAMKEI
FTASSQTFNTGEAMKELPTAFTGENALPLLDGDLHKHRKRMLMPAFHGERLRAYSELIYD
LTKQEIEQWTKGEPFHVQASMQDISLKFIIRAIFGVNDEDRFQQFKKTLISLLNLLSDPW
TSIVLYFRALQQDWGSWSLWGRFVRLRQQVDDIIYAEIKRRRDDPALLGEDILSLMMSAR
NEQGELINDVELRDDLMILLLGGHETTSMSMTWALYWIHHFPQVYETLMAELDTLDDYQD
SSAIMKLPYLDAVCHETLRIYPPTILGAYRIAQKPVEIMSHKFEAGTFILPCIYLTHRQE
DLYPEPNHFRPERFLERQFSAYEFVAFGGGSRRCIGYALSLFEMKLILATILTNLKLALP
DNRVIKPVRSAFTVAPSPMYMIRA
selected fasta
>putative cytochrome P450 [HctH]
ATGATGAAATTTCCTGATGGACCAAAAACTCCAGCATTGCTACAGTCTATTAATCTCATA
GTTAATCCTCTCAATTACTTAGAGGATTGTGCTAAACGCTACGGGGATATCTTTACAATA
CGTTTTTTGAACTATCCTCCAACGGTGCTTGTTAGCCATCCCCAGGCGATGAAGGAAATA
TTTACAGCAAGCTCCCAAACATTTAATACAGGGGAAGCCATGAAGGAGTTACCAACTGCT
TTTACAGGAGAAAATGCGCTACCCTTGTTAGATGGAGATCTGCATAAACATCGCAAAAGA
ATGTTGATGCCTGCTTTCCATGGTGAGCGACTACGAGCGTATAGCGAGTTAATCTATGAT
CTTACTAAGCAAGAAATAGAGCAGTGGACGAAGGGAGAACCTTTTCATGTTCAGGCTTCT
ATGCAAGATATCTCACTCAAATTCATTATTCGTGCTATTTTTGGGGTCAATGACGAAGAC
CGTTTCCAACAGTTTAAGAAAACCTTGATTTCACTGCTGAATTTGTTGAGTGATCCTTGG
ACCTCTATTGTTTTGTACTTTCGCGCCCTGCAGCAGGATTGGGGATCTTGGAGCTTATGG
GGACGTTTTGTCCGTCTTCGTCAGCAGGTCGATGACATTATTTATGCTGAGATTAAGCGA
CGTCGAGATGATCCGGCCTTATTAGGTGAAGATATTCTTAGCTTGATGATGAGTGCTCGT
AATGAGCAAGGCGAGCTGATAAATGATGTGGAATTGCGCGACGATTTAATGATCCTCCTT
CTAGGAGGCCATGAAACCACTTCCATGAGTATGACTTGGGCACTGTACTGGATTCATCAC
TTTCCTCAGGTGTATGAAACGCTTATGGCTGAACTAGACACCCTTGATGATTATCAAGAT
TCAAGCGCTATTATGAAGCTTCCCTATTTGGATGCCGTTTGTCACGAAACCCTACGAATA
TACCCACCTACTATTTTGGGAGCGTACCGTATTGCTCAAAAGCCTGTGGAAATTATGAGC
CACAAATTTGAGGCAGGGACATTTATTTTGCCCTGTATCTATTTAACTCATAGGCAAGAA
GATTTATATCCAGAGCCAAATCATTTTAGACCAGAGCGTTTTTTGGAGCGACAGTTTTCA
GCGTATGAATTTGTGGCTTTTGGTGGTGGAAGCCGTCGATGTATTGGATATGCATTATCT
TTGTTTGAAATGAAATTAATCCTGGCGACAATTCTGACTAACCTAAAACTAGCCCTACCT
GATAACCGTGTTATCAAGCCTGTACGTAGCGCCTTTACTGTTGCACCCTCCCCAATGTAT
ATGATTCGTGCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [17-440]  1.9e-78 PF00067
PF00067   p450
 [5-443]  9.40003071030835e-101 SSF48264
SSF48264   Cytochrome_P450
 [262-279]  1.49999977583352e-11 PR00385 [312-323]  1.49999977583352e-11 PR00385 [385-394]  1.49999977583352e-11 PR00385 [394-405]  1.49999977583352e-11 PR00385
PR00385   P450
 [3-441]  1.99999999999999e-101 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [31-50]  1.99999636034521e-25 PR00463 [251-268]  1.99999636034521e-25 PR00463 [271-297]  1.99999636034521e-25 PR00463 [311-329]  1.99999636034521e-25 PR00463 [352-376]  1.99999636034521e-25 PR00463 [384-394]  1.99999636034521e-25 PR00463 [394-417]  1.99999636034521e-25 PR00463
PR00463   EP450I
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [387-396]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit
Hecto_00070 Hecto_00070   last last