close all open/close all
first first   Heda_00020 Heda_00020

CDS information : Heda_00010


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction6,378 / 1 / - [in whole cluster]
6,378 / 1 / - [in contig]
Locationcomplement(1..6378) [in whole cluster]
complement(1..6378) [in contig]
TypeCDS
Length6,378 bp (2,125 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I PKS
GenehedU
Gene (GenBank)
EC number
Keyword
  • starter unit
Note
Note (GenBank)
  • orf32
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

1 malonyl-CoA
2
KS48..422
AT574..886
DH931..1091
KR1380..1560
ACP1664..1734
KS1766..2124

close this sectionSequence

selected fasta
>polyketide synthase [type I PKS]
MIFEHPTPRALADHLAELLHPADRDRPAAPALLTSPPAPSDTTDPDNDAIAIIGIGCRFP
GGITTPEQLWQLLTEERHAITDFPTNRGWPDNLHHPDPTHPGTTYTRKGGFLHDADQFDA
HFFGISPREALAMDPQQRSLLETAWHTLEHAGIDPTTLHGTDTGVFVGASPLEYGPRMQD
APPSVQGHVMTGVSPSILSGRLAYQFGFTGPALTLDTACSSSLVALHTATQALRNNECTL
ALVGGTTIMATPGTFIEFSRLQGLSPDGHCRSFSAHANGTGWSEGTALLLLEPLTQAQRN
NHTVHAVIRATATNQDGPSNGLTAPNGQAQQRLIHHTLTTAHLTPHDIDAIEAHGTATPL
GDPIEARALMETYGRDRPADRPVYLGSVKSNLGHTQAAAGAAGVIKMIQALHHNLLPKTL
HTDQPTPHIDWNNTPLQLLTQPQPWPHNPHRPRRAAISSFGISGTNAHLILEEPPTTPTP
QQPTTLPITPYILTAKTPTALHTHAHHLTQHPTHHHPTHTAHTLATRTHHPHRAVILTPD
PTTLTTTLHHLTTNQPHPHLTTGSVTGDGRLGLLFPGQGAQQTGAGRELYDAFPGFAEAL
DAVLEELDRHLDRPLRSVMWGEDDELLNLTQYAQPALFALEVALFRLVESWGIEPDVLIG
HSVGELAAAHAAGILTLGDACALVAARGRLMGALPEDGAMLAVEASEEELAPLLGDEVDL
AAVNGPTSLVVSGTASAVDCLAARWTARGRRATRLRVSHAFHSRLMEPMLARFAEVAEGL
AYGAPRIPVVSTLTGAVVTDEAMSGASYWVRHARETVRFADAVRTTADRGVGALLELGPR
GTLSGMVPDCLPEPDVMIAVPALPENRTEAAALLSSVAQVFVRGTDVDWTRLFHGTGARH
VDLPLYPFERQRYWLTAPRATAATGLAATSHPFLGATTELAADRTTLFSGRVSVQDHPWL
ADHRIDGVVLLPGTALLELALHAGRHTGCPHIEELTLTAPVVLGEEDARAVQLLVGAPDS
AGRRSLTVHTRPQDGDEPWTTHAAAVLAPNGPSASVDPVELPPDAEDVAFEDLYSRCASA
GYGYGPAFRRVHRLRRHGDDVHAELSPPTGAGFHLHPALLDAALHPLLPTDAGDTLLPFA
FSGVTLHDTPPVSGAVHVHARLAGLDDQGTRASLVLTGPDGTPFASVHDVVLRPARPLDA
GLHTVAWAAAGERTAAPDTTAWALVTADGTAPAPLPLAHTVHSDLATVPTDAPATVVLPL
RADPRAPHALLARVQQWLTGPHHPDGRLVVVTGGPADDRAGVHQAAACGLLLSAISEHPG
RFVLADLDEEPSSWAALPEAVATGEPRLRIRSGQVSVPRLAPVPHAGSKAAASPVFSPEG
TVLVTGGTGRLGALLARHLVARHGVRHLLLVSRRGADAPGAAELTAELRDAGARVTVRAC
DAADREALAAVLEDVPAPHPLTAVIHTAGVLDDCVVERLTPGRLDAVLRPKADAAWHLHE
LTRDLGLRAFVLFSSVSGLIGTAGQANYAAANAFLDALAGHRRRLALPATSLAWGLWAGD
GGMAGALGAQDIARFAREGIAPLEPEEALRLFDAALAHEEALLAPVRVDRAALRRRARSG
ADISPLMREAAGGTPRACEHDGSGAVPLSGRLAGRSEAERRRVLSDVVHTQAAAVLGFAD
PSGIVSERAFKELGFDSLTSVELRNRLNSATGLRLSAGVIFEHPTPRALADHLAELLHPA
DRDRPAAPALLTSPPAPSDTTDPDNDAIAIIGIGCRFPGGITTPEQLWQLLTEERHAITD
FPTNRGWPDNLHHPDPTHPGTTYTRKGGFLHDADQFDAHFFGISPREALAMDPQQRSLLE
TAWHTLEHAGIDPTTLHGTDTGVFVGMMYHDYAPAAGQMPRDLEGLLLTGNLGSVLSGRL
AYQFGFTGPALTLDTACSSSLVALHTATQALRNNECTLALAGGTTIMATPGTFIEFSRLQ
GLSPDGHCRSFSAHANGTGWSEGTALLLLEPLTQAQRNNHTVHAVIRATATNQDGPSNGL
TAPNGQAQQRLIHHTLTTAHLTPHDIDAIEAHGTATPLGDPIEVQALHTVYGQDRTRPLW
LGSLKSNLGHTQAAAGAAGVIKMIH
selected fasta
>polyketide synthase [type I PKS]
GTGATCTTCGAGCATCCGACGCCGCGGGCGCTGGCCGACCACCTCGCGGAACTGCTGCAC
CCCGCAGACCGGGACCGGCCCGCCGCCCCCGCACTCCTCACCTCACCCCCGGCGCCCTCC
GACACCACCGACCCCGACAACGACGCCATCGCCATCATCGGCATCGGCTGCCGCTTCCCC
GGCGGAATCACCACCCCCGAACAACTCTGGCAACTCCTCACCGAAGAACGCCACGCCATC
ACCGACTTCCCCACCAACCGCGGCTGGCCCGACAACCTCCACCACCCCGACCCCACCCAC
CCCGGCACCACCTACACCCGCAAAGGCGGCTTCCTCCACGACGCCGACCAGTTCGACGCC
CACTTCTTCGGCATCTCCCCCCGCGAAGCCCTCGCCATGGACCCCCAGCAACGCAGCCTC
CTCGAAACCGCCTGGCACACCCTCGAACACGCCGGCATCGACCCCACCACCCTCCACGGC
ACCGACACCGGCGTCTTCGTCGGGGCATCGCCGCTGGAGTACGGGCCGCGGATGCAGGAC
GCGCCGCCCTCGGTCCAGGGTCACGTGATGACGGGTGTGTCGCCGAGCATCCTGTCGGGG
CGGCTGGCGTACCAGTTCGGGTTCACCGGCCCCGCGCTCACCCTCGACACCGCCTGCTCC
TCCTCCCTCGTCGCCCTCCACACCGCCACCCAAGCCCTCCGCAACAACGAATGCACCCTC
GCCCTCGTCGGCGGCACCACCATCATGGCCACCCCAGGCACCTTCATCGAATTCAGCCGC
CTCCAAGGACTCTCCCCCGACGGACACTGCCGCTCCTTCTCCGCCCACGCCAACGGCACC
GGCTGGTCCGAAGGAACAGCCCTCCTCCTCCTCGAACCCCTCACCCAAGCACAACGCAAC
AACCACACCGTCCACGCCGTCATCCGCGCCACCGCCACCAACCAGGACGGCCCCTCCAAC
GGCCTCACCGCCCCCAACGGCCAAGCCCAACAACGCCTCATCCACCACACCCTCACCACC
GCCCACCTCACCCCCCACGACATCGACGCCATCGAAGCCCACGGCACCGCCACCCCCCTC
GGCGACCCCATCGAGGCCCGGGCCCTGATGGAGACCTACGGCCGGGACCGGCCCGCCGAC
CGGCCGGTGTACCTGGGCTCGGTCAAGTCCAATCTCGGGCACACCCAAGCCGCCGCCGGA
GCCGCCGGCGTCATCAAAATGATCCAAGCCCTCCACCACAACCTCCTCCCCAAAACCCTC
CACACCGACCAACCCACCCCCCACATCGACTGGAACAACACCCCCCTCCAACTCCTCACC
CAACCCCAACCCTGGCCCCACAACCCCCACCGACCCCGCCGCGCAGCCATCTCCTCCTTC
GGCATCAGCGGCACCAACGCCCACCTCATCCTCGAAGAACCCCCCACCACCCCCACCCCC
CAACAACCCACCACCCTCCCCATCACCCCCTACATCCTCACCGCCAAGACCCCCACCGCC
CTCCACACCCACGCACACCACCTCACCCAACACCCCACCCACCACCACCCCACCCACACC
GCCCACACCCTCGCCACCCGCACCCACCACCCCCACCGCGCCGTCATCCTCACCCCCGAC
CCCACCACCCTCACCACCACCCTCCACCACCTCACCACCAACCAACCCCACCCCCACCTC
ACCACCGGCAGCGTCACCGGCGACGGCAGGCTCGGTCTGCTCTTCCCCGGCCAGGGCGCC
CAGCAGACGGGCGCCGGACGTGAGCTCTACGACGCGTTCCCGGGTTTCGCCGAAGCGCTC
GACGCCGTCCTGGAGGAGCTGGACCGGCACCTGGACCGGCCCCTGCGCTCGGTGATGTGG
GGCGAGGACGACGAGTTGTTGAACCTCACTCAGTACGCGCAGCCGGCCCTCTTCGCCCTG
GAGGTGGCCCTGTTCCGCCTCGTGGAGTCGTGGGGGATCGAGCCGGACGTGCTGATCGGC
CACTCGGTGGGCGAGTTGGCCGCGGCCCACGCCGCCGGCATCCTCACCCTGGGTGACGCC
TGCGCCCTGGTCGCCGCCCGAGGACGGCTGATGGGCGCCCTTCCGGAAGACGGCGCGATG
CTGGCGGTGGAGGCGTCCGAGGAGGAACTGGCGCCGCTGCTGGGCGACGAGGTGGACCTC
GCCGCGGTCAACGGCCCCACGTCGCTGGTGGTGTCCGGCACCGCCTCGGCGGTCGACTGT
CTCGCCGCACGCTGGACGGCACGCGGGCGCAGGGCCACCCGGCTGCGGGTCAGCCATGCC
TTCCACTCACGGCTGATGGAGCCGATGCTGGCCCGGTTCGCCGAGGTGGCGGAAGGGCTG
GCCTACGGCGCTCCGCGGATACCGGTGGTGTCCACCCTGACGGGCGCGGTGGTGACGGAC
GAGGCGATGTCCGGCGCCTCGTACTGGGTGCGGCACGCGCGGGAGACGGTCCGCTTCGCA
GACGCGGTGCGGACCACGGCGGACCGCGGTGTCGGCGCGCTGCTGGAGCTGGGGCCACGG
GGGACGCTGTCGGGCATGGTGCCGGACTGCCTTCCGGAGCCGGACGTGATGATCGCGGTG
CCCGCGCTGCCCGAAAACCGGACGGAGGCGGCGGCCCTGCTGTCGTCCGTGGCGCAGGTG
TTCGTCCGCGGCACCGACGTGGACTGGACGCGCCTGTTCCACGGCACCGGCGCCCGCCAC
GTCGACCTGCCCCTCTACCCCTTCGAACGACAGCGGTACTGGCTGACGGCGCCCCGCGCC
ACGGCCGCCACGGGTCTGGCCGCCACCTCGCACCCCTTCCTCGGCGCGACCACCGAACTC
GCCGCCGACCGCACGACGTTGTTCTCCGGGCGGGTCAGTGTCCAGGACCACCCGTGGCTG
GCCGACCACCGGATCGACGGCGTCGTCCTGCTGCCGGGCACGGCCCTGCTGGAGCTGGCC
CTGCACGCCGGACGGCACACCGGCTGCCCGCACATCGAGGAGCTGACCCTCACCGCCCCG
GTCGTCCTGGGCGAGGAGGACGCCCGCGCAGTCCAACTGCTCGTCGGCGCACCGGACTCC
GCGGGACGCCGCTCCCTGACCGTCCACACCCGGCCGCAGGACGGGGACGAGCCGTGGACC
ACGCACGCCGCCGCGGTCCTCGCCCCCAACGGCCCGTCCGCGTCCGTTGACCCCGTCGAA
CTGCCCCCGGACGCCGAGGACGTGGCGTTCGAGGACCTCTACAGTCGCTGTGCGTCCGCC
GGGTACGGCTACGGTCCCGCCTTCCGCCGGGTCCACCGGCTCCGCCGGCACGGGGACGAC
GTCCACGCCGAGCTGTCGCCGCCCACCGGCGCCGGCTTCCACCTCCACCCGGCCCTCCTG
GACGCCGCGCTGCACCCGCTGCTGCCCACCGACGCCGGCGACACCCTGCTGCCGTTCGCC
TTCTCGGGCGTCACCCTGCACGACACGCCGCCCGTCTCCGGCGCCGTGCACGTCCACGCC
CGGCTCGCCGGACTGGACGACCAGGGCACCCGTGCCTCACTCGTGCTGACCGGCCCCGAC
GGGACCCCGTTCGCCTCGGTCCACGATGTCGTCCTGCGCCCGGCACGTCCCCTCGACGCC
GGGCTCCACACCGTGGCCTGGGCTGCTGCCGGGGAGCGGACGGCCGCGCCGGACACCACC
GCCTGGGCGCTCGTCACCGCCGACGGGACGGCGCCCGCGCCGCTCCCCCTGGCCCACACC
GTCCATTCCGACCTCGCTACCGTGCCCACCGATGCCCCCGCCACGGTGGTGCTGCCCCTG
AGGGCGGACCCCCGCGCGCCGCACGCGCTCCTCGCCCGCGTCCAGCAGTGGCTCACCGGC
CCGCACCACCCGGACGGCCGACTGGTGGTGGTCACCGGCGGGCCGGCCGACGACCGGGCC
GGGGTGCACCAGGCGGCGGCGTGCGGTCTGCTGTTGTCGGCGATCTCCGAGCACCCGGGG
CGCTTCGTCCTGGCCGACCTCGACGAGGAGCCGTCGTCCTGGGCGGCTCTGCCCGAGGCG
GTCGCGACCGGGGAGCCGCGGCTGCGGATCCGGTCCGGTCAGGTGTCCGTACCCCGGCTG
GCGCCCGTGCCGCACGCCGGCTCCAAGGCCGCCGCCTCCCCGGTCTTCTCGCCGGAGGGC
ACTGTCCTGGTGACCGGCGGCACCGGCAGGCTCGGCGCCCTGCTGGCCCGGCACCTCGTC
GCGCGTCACGGCGTACGGCACCTGCTGCTGGTCAGCCGCCGGGGAGCGGACGCACCCGGA
GCCGCCGAGCTGACGGCGGAACTGCGCGACGCCGGCGCCCGGGTCACCGTGAGGGCCTGT
GACGCCGCCGACCGGGAGGCACTGGCCGCCGTGCTGGAGGACGTACCGGCTCCACACCCG
CTCACCGCGGTGATCCACACGGCCGGTGTACTGGACGACTGCGTCGTGGAGCGGCTGACA
CCGGGACGGCTGGACGCGGTGCTGCGGCCCAAGGCCGACGCCGCGTGGCACCTGCACGAG
CTGACCCGGGACCTGGGCCTGCGGGCCTTCGTCCTGTTCTCGTCCGTCTCCGGGCTGATC
GGCACGGCCGGACAGGCCAATTACGCTGCGGCCAACGCGTTCCTCGACGCGCTGGCCGGG
CACCGTCGACGGCTCGCCCTCCCGGCGACCTCCCTCGCCTGGGGGCTGTGGGCGGGCGAC
GGCGGCATGGCCGGGGCGCTCGGCGCCCAGGACATCGCCCGGTTCGCCCGCGAGGGCATC
GCGCCGCTGGAGCCGGAGGAGGCGCTGCGTCTGTTCGACGCGGCCCTGGCGCACGAGGAG
GCGCTTCTCGCACCGGTGCGCGTGGACCGGGCGGCGCTGCGTCGGCGCGCGCGGTCCGGT
GCGGACATCTCGCCACTGATGCGGGAGGCGGCCGGCGGAACGCCGCGCGCCTGCGAGCAC
GACGGGAGCGGGGCGGTCCCACTGTCCGGGCGGCTCGCCGGCCGGTCCGAGGCGGAGCGC
CGACGCGTCCTGTCGGACGTGGTCCACACCCAGGCCGCGGCCGTGCTCGGCTTCGCCGAC
CCGAGCGGCATCGTGTCCGAACGGGCCTTCAAGGAGCTGGGCTTCGACTCGCTGACCTCG
GTGGAACTGCGCAACCGGCTCAACTCGGCGACCGGATTGCGGCTGTCGGCGGGCGTGATC
TTCGAGCATCCGACACCGCGGGCGCTGGCCGACCACCTCGCGGAACTGCTGCACCCCGCA
GACCGGGACCGGCCCGCCGCCCCCGCACTCCTCACCTCACCCCCGGCGCCCTCCGACACC
ACCGACCCCGACAACGACGCCATCGCCATCATCGGCATCGGCTGCCGCTTCCCCGGCGGA
ATCACCACCCCCGAACAACTCTGGCAACTCCTCACCGAAGAACGCCACGCCATCACCGAC
TTCCCCACCAACCGCGGCTGGCCCGACAACCTCCACCACCCCGACCCCACCCACCCCGGC
ACCACCTACACCCGCAAAGGCGGCTTCCTCCACGACGCCGACCAGTTCGACGCCCACTTC
TTCGGCATCTCCCCCCGCGAAGCCCTCGCCATGGACCCCCAGCAACGCAGCCTCCTCGAA
ACCGCCTGGCACACCCTCGAACACGCCGGCATCGACCCCACCACCCTCCACGGCACCGAC
ACCGGCGTCTTCGTGGGCATGATGTACCACGACTACGCGCCGGCCGCGGGGCAGATGCCC
AGGGACCTGGAGGGGCTGCTGCTGACCGGGAACCTCGGCAGTGTGCTCTCGGGGCGGCTG
GCGTACCAATTCGGGTTCACCGGCCCCGCGCTCACCCTCGACACGGCCTGCTCCTCCTCC
CTCGTCGCCCTCCACACCGCCACCCAAGCCCTCCGCAACAACGAATGCACCCTCGCCCTC
GCCGGCGGCACCACCATCATGGCCACCCCAGGCACCTTCATCGAATTCAGCCGCCTCCAA
GGACTCTCCCCCGACGGACACTGCCGCTCCTTCTCCGCCCACGCCAACGGCACCGGCTGG
TCCGAAGGAACAGCCCTCCTCCTCCTCGAACCCCTCACCCAAGCACAACGCAACAACCAC
ACCGTCCACGCCGTCATCCGCGCCACCGCCACCAACCAGGACGGCCCCTCCAACGGCCTC
ACCGCCCCCAACGGCCAAGCCCAACAACGCCTCATCCACCACACCCTCACCACCGCCCAC
CTCACCCCCCACGACATCGACGCCATCGAAGCCCACGGCACCGCCACCCCCCTCGGCGAC
CCCATCGAAGTCCAGGCACTCCACACCGTCTACGGCCAAGACCGCACCCGCCCCCTGTGG
CTCGGCTCCCTCAAGTCCAACCTCGGGCACACCCAAGCCGCCGCCGGAGCCGCCGGCGTC
ATCAAAATGATCCACTAG
[1] KS48..422
[1] AT574..886
[1] malonyl-CoA759..763
[1] DH931..1091
[1] KR1380..1560
[1] ACP1664..1734
[2] KS1766..2124
[1] KS142..1266
[1] AT1720..2658
[1] malonyl-CoA2275..2289
[1] DH2791..3273
[1] KR4138..4680
[1] ACP4990..5202
[2] KS5296..6372

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [572-691]  1.69999999999998e-74 G3DSA:3.40.366.10 [758-862]  1.69999999999998e-74 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1692-1707]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1-64]  1.40000045763982e-06 SSF47336 [1657-1782]  5.10001002358244e-25 SSF47336
SSF47336   ACP_like
 [1664-1737]  2.2e-23 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1668-1733]  4.00000000000001e-12 PF00550
PF00550   PP-binding
 [1664-1734]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1380-1559]  2.19999999999997e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [48-297]  1.99999999999999e-88 PF00109 [1766-2015]  2.59999999999995e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [305-422]  6.09999999999996e-43 PF02801 [2023-2124]  6.6999999999999e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [574-886]  3.40000000000004e-60 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-878]  8.99992502689852e-72 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-758]  1.20000117458134e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [50-309]  G3DSA:3.40.47.10 [311-476]  6.90000000000007e-101 G3DSA:3.40.47.10 [1768-2027]  G3DSA:3.40.47.10 [2029-2124]  6.90000000000007e-101 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [40-421]  2.19999900980707e-96 SSF53901 [1758-2125]  7.49999605851445e-95 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1380-1566]  1.09999999999999e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [210-226]  PS00606 [1928-1944]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [574-867]  1e-120 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1665-1737]  2.30000440726534e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [931-1091]  5.10003242202156e-73 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [50-476]  SM00825 [1768-2125]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1380-1560]  5.20000089003336e-65 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit
first first   Heda_00020 Heda_00020