close all open/close all

CDS information : Heda_00030


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction10,434 / 9,388 / - [in whole cluster]
10,434 / 9,388 / - [in contig]
Locationcomplement(9388..10434) [in whole cluster]
complement(9388..10434) [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyltransferase
Product (GenBank)putative 3-oxoacyl-ACP synthase
GenehedS
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf30
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)
Related Reference
ACC
Q54816
NITE
Adria_00290
PmId
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[10423255] Purification and properties of the Streptomyces peucetius DpsC beta-ketoacyl:acyl carrier protein synthase III that specifies the propionate-starter unit for type II polyketide biosynthesis. (Biochemistry. , 1999)

close this sectionSequence

selected fasta
>putative acyltransferase [putative 3-oxoacyl-ACP synthase]
MRFEDIHVRATATWLPPRRSLADAVAAGDCPPVVAARTGMESVTVSDDAAAPEMAVRAAR
TALARAGSTSADVDLILHADTWFQGHDAWAVASYVQRETLANQCPAVEIRQMSNGGMAAL
DLAASYLAGAPERRDALLTTGDRYCMPGFDRWRTDPGTPYADGGTALVLSRREGFARLTS
LVMSADPELEPLHRGDDPFAAAPLSHRTPLSFEDTTRVFNRRHGLSFALRRLAEGQTTVI
KHALSDAGLALPEIDWVVLPHFGRLRLESLYYERFGIDPARTAWEWSRTVGHLGAGDQFA
SLDHLAGSGRAVPGDRCLLVGAGAGYSWGCAVLEITRRPDWASPHAAR
selected fasta
>putative acyltransferase [putative 3-oxoacyl-ACP synthase]
GTGAGGTTCGAAGACATCCATGTGCGGGCCACCGCCACCTGGCTGCCGCCCCGCCGCTCG
CTCGCCGACGCCGTCGCGGCGGGCGACTGCCCGCCCGTGGTGGCCGCCCGCACCGGCATG
GAGTCCGTGACGGTCTCCGACGACGCCGCGGCGCCCGAGATGGCCGTCCGGGCGGCGCGG
ACCGCGCTGGCCCGGGCCGGGTCCACGTCCGCCGACGTCGATCTCATCCTGCACGCCGAC
ACCTGGTTCCAGGGGCACGACGCCTGGGCCGTGGCCTCGTACGTGCAGCGCGAGACCTTG
GCCAACCAGTGCCCGGCCGTGGAGATCCGGCAGATGTCCAACGGCGGCATGGCCGCGCTG
GATCTGGCGGCTTCCTATCTGGCGGGCGCCCCGGAACGGCGGGACGCGCTGCTGACCACC
GGAGACCGGTACTGCATGCCCGGCTTCGACCGCTGGCGCACGGACCCGGGCACGCCGTAC
GCCGACGGCGGGACCGCGCTCGTCCTCTCCCGCCGCGAGGGCTTCGCCCGGCTGACGTCC
CTGGTGATGTCCGCGGACCCCGAGCTGGAGCCGCTGCACCGCGGCGACGACCCGTTCGCG
GCGGCGCCGCTCAGCCATCGCACGCCGCTGTCCTTCGAGGACACGACCCGGGTCTTCAAC
CGGCGGCACGGTCTGTCGTTCGCGCTGCGCCGGCTCGCCGAGGGTCAGACCACGGTGATC
AAGCACGCACTGTCCGACGCGGGACTCGCACTGCCGGAGATCGACTGGGTGGTGCTGCCG
CACTTCGGCCGACTGCGCCTGGAGTCCCTGTACTACGAACGGTTCGGGATCGACCCGGCG
CGCACCGCCTGGGAGTGGAGCCGCACCGTCGGTCACCTCGGCGCCGGGGACCAGTTCGCG
AGCCTGGACCACCTGGCCGGCTCGGGCAGGGCAGTGCCGGGCGACCGCTGTCTGCTGGTC
GGCGCCGGCGCGGGCTACAGCTGGGGCTGCGCGGTACTGGAGATCACACGGCGACCGGAC
TGGGCCTCGCCGCACGCCGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [244-335]  1.1e-21 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [108-184]  7.1e-05 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [4-166]  1.2e-21 G3DSA:3.40.47.10 [167-334]  1.2e-22 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-338]  3.39999972437717e-30 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-22]  0.397 Signal
Bacteria, Gram-negative   
 [1-26]  0.382 Signal
Bacteria, Gram-positive   
 [1-36]  0.196 Signal
Eukaryota   
TMHMM No significant hit