close all open/close all

CDS information : Heda_00040


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction11,740 / 10,511 / - [in whole cluster]
11,740 / 10,511 / - [in contig]
Locationcomplement(10511..11740) [in whole cluster]
complement(10511..11740) [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450
GenehedR
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf29
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q59831
PmId
[7557483] Cloning, characterization and expression of the gene encoding cytochrome P-450sca-2 from Streptomyces carbophilus involved in production of pravastatin, a specific HMG-CoA reductase inhibitor. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MTTADISTESTGQPAQETFPYERACPFSPPRQYAELIDRRPVAKVRLATGREAWVVSGLR
EARQILTTDKVSSSRTHANYPFYFDAPPQMRTDSSFIAYDPPRHTEARRKVAASFTHRNV
QRLRASMERTTDACIDALLAAGPPADLHRLVSLPAPMAMICDLLGVPAEDRGFLQQHGER
LFGGTSSQAEREAAVVEVGAYLEDLVRRKEREPGDDLISRTVAAYRAEDGDYDVRDVVNT
CRMLINGGHETTANHITLGVAALLEHPEQMAALVADPSLIHAAVEELVRWLGLGDLAVPR
VALEDIEIGGEVIPEGAGILVLLQGANRDPRAFDRPDRLVLARGSRRHIGFGHGAHLCIG
ADLARLELEIVLTRLLQRVPALRLATPVGELRTKERAIVYGVWGLDVAW
selected fasta
>putative cytochrome P450 [cytochrome P450]
ATGACCACGGCCGACATCAGCACCGAGTCCACGGGGCAGCCCGCCCAGGAGACCTTTCCC
TACGAGCGGGCCTGCCCGTTCTCCCCGCCCCGGCAGTACGCGGAGCTGATCGACCGGCGG
CCGGTGGCCAAGGTGCGGCTCGCCACGGGCCGCGAGGCATGGGTGGTGAGCGGTCTGCGC
GAGGCCCGGCAGATCCTCACCACCGACAAGGTCAGCTCCTCGCGCACACACGCCAACTAC
CCGTTCTACTTCGACGCGCCGCCGCAGATGCGCACCGACAGCTCCTTCATCGCCTACGAC
CCGCCCCGGCACACCGAGGCCCGGCGCAAGGTCGCCGCGTCCTTCACGCACCGGAACGTC
CAGCGGCTGCGCGCGAGCATGGAGCGCACCACCGACGCCTGCATCGACGCCCTGCTGGCC
GCGGGGCCGCCGGCCGACCTGCACCGGCTGGTTTCCCTGCCCGCGCCGATGGCGATGATC
TGCGACCTGCTCGGCGTGCCGGCCGAGGACCGGGGGTTCCTCCAGCAGCACGGCGAACGG
CTGTTCGGCGGCACCAGTTCGCAGGCCGAGCGCGAGGCGGCGGTGGTGGAGGTGGGCGCG
TACCTGGAAGACCTGGTGCGCCGCAAGGAACGTGAGCCCGGCGACGACCTGATCAGCAGG
ACGGTGGCCGCGTACCGCGCCGAGGACGGCGACTACGACGTCCGGGACGTGGTGAACACC
TGCCGGATGCTGATCAACGGCGGACACGAGACGACCGCCAACCACATCACGCTCGGCGTC
GCCGCGCTCCTGGAGCACCCCGAGCAGATGGCCGCTCTCGTCGCCGACCCGTCCCTGATC
CACGCGGCGGTGGAGGAGCTGGTGCGCTGGCTCGGTCTCGGCGACCTCGCGGTGCCCCGC
GTGGCTCTGGAGGACATCGAGATCGGCGGTGAGGTCATCCCCGAGGGCGCCGGCATCCTG
GTCCTGCTCCAGGGGGCCAACCGCGATCCGCGCGCCTTCGACCGGCCCGACCGGCTGGTC
CTCGCCCGCGGCAGCAGGCGGCACATCGGGTTCGGTCACGGTGCCCATCTGTGCATCGGC
GCCGACCTGGCCCGCCTCGAGCTGGAGATCGTGCTCACCAGGCTCCTCCAGCGCGTCCCC
GCCCTGCGCCTGGCCACGCCGGTCGGCGAACTGCGCACCAAGGAACGGGCGATCGTCTAC
GGCGTGTGGGGACTGGACGTCGCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [247-264]  9.8000027213022e-06 PR00385 [282-293]  9.8000027213022e-06 PR00385 [349-358]  9.8000027213022e-06 PR00385 [358-369]  9.8000027213022e-06 PR00385
PR00385   P450
 [18-409]  4.50001022902825e-91 SSF48264
SSF48264   Cytochrome_P450
 [215-378]  1.69999999999999e-21 PF00067
PF00067   p450
 [17-409]  8.10000000000001e-100 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [99-110]  1.10000150671643e-49 PR00359 [146-162]  1.10000150671643e-49 PR00359 [163-178]  1.10000150671643e-49 PR00359 [200-222]  1.10000150671643e-49 PR00359 [282-293]  1.10000150671643e-49 PR00359 [300-327]  1.10000150671643e-49 PR00359 [328-343]  1.10000150671643e-49 PR00359 [349-358]  1.10000150671643e-49 PR00359 [358-369]  1.10000150671643e-49 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [351-360]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-34]  0.068 Signal
Bacteria, Gram-negative   
TMHMM No significant hit