close all open/close all

CDS information : Heda_00050


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction14,167 / 11,885 / - [in whole cluster]
14,167 / 11,885 / - [in contig]
Locationcomplement(11885..14167) [in whole cluster]
complement(11885..14167) [in contig]
TypeCDS
Length2,283 bp (760 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative UvrA-like protein
Product (GenBank)UvrA-like drug resistance protein
GeneorfH11
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf28
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q54827
NITE
Adria_00370
PmId
[8655504] The Streptomyces peucetius drrC gene encodes a UvrA-like protein involved in daunorubicin resistance and production. (J Bacteriol. , 1996)
[9835035] The DrrC protein of Streptomyces peucetius, a UvrA-like protein, is a DNA-binding protein whose gene is induced by daunorubicin. (FEMS Microbiol Lett. , 1998)

close this sectionSequence

selected fasta
>putative UvrA-like protein [UvrA-like drug resistance protein]
MTTTPDTGSDDGVRIVGARENNLKDVSLTIPRNRITVFTGVSGSGKSSLVFDTLAVESQR
QLYATFNWFIRNQLPRYGRPHVTAVENLTAPVVVDQKPLGGNARSTVGTLTDLSSTLRVL
FSHCAEPALPPGAYSFNDPQGMCPQCEGLGQERQVDVERMLDRSKSLDEGAILLPTHKVG
SMDWQQYANSGHFDTSKRLCDYTEQEWHTLLHGSGGTVTVRTANTTTTLAYEGVVARFAR
TNLKRDLSTLGERARANVERFVSLGPCTSCGGARLAPPTLASTIEGRTIADLSRMEVGEL
VPFLETITDPVGAQIAADLREGLSRVVAIGLGYLSLDRSSTSLSGGEAQRLKMVRHLSSS
LTGMTYVFDEPSTGLHPQDVGRLGELMRALCDRGNTLVVVEHDPDVIALADHVVDLGPGA
GPHGGEVVYTGPFGGLLGADTVTGRALRRRGTVKPEARRPTGKLSVEGADLNNLRNVSVA
FPTGVLTAVTGVAGSGKSSLVTGAFRQAHPDAVFVDQSPVRASARSTPVSFLQAMDPLRK
LFARATGAPAGLFSFNSAGACGTCQGRGEIVTELAYMDPVRLPCEGCGGRRFQEEVLRHR
LRGRSVADVLEMTAQDALDFFTEPEITGRISRLVDVGLPYLTLGRSLSTLSGGERQRLKL
AGQLERSHGVYVLDEPTTGLHRADVDGLVALLDRLVDRGNTVIVVEHDLEVVRRADWVVD
LGPGGGRHGGEVVFTGTPAALLAAEGSVTGEHLRRFCAGG
selected fasta
>putative UvrA-like protein [UvrA-like drug resistance protein]
GTGACGACAACGCCGGACACGGGTTCCGACGACGGCGTCAGGATCGTCGGAGCCCGTGAG
AACAACCTCAAGGACGTGTCGCTGACGATCCCGAGGAACCGGATCACCGTGTTCACCGGG
GTGTCCGGCTCGGGCAAGTCGTCGCTGGTGTTCGACACCCTGGCGGTGGAGTCCCAACGG
CAGTTGTACGCCACCTTCAACTGGTTCATCCGCAACCAGCTTCCCCGCTACGGCCGCCCG
CACGTGACCGCGGTGGAGAACCTGACCGCTCCCGTCGTGGTCGACCAGAAGCCGCTCGGC
GGCAACGCGCGCTCCACCGTCGGCACCCTGACGGACCTGTCGTCGACGCTGCGCGTGCTG
TTCTCCCACTGCGCCGAGCCGGCCCTGCCGCCCGGTGCGTACTCCTTCAACGACCCGCAG
GGCATGTGCCCGCAGTGCGAGGGCCTGGGGCAGGAGCGCCAGGTGGACGTGGAGCGGATG
CTGGACCGCTCCAAGTCCCTGGACGAGGGTGCCATCCTGCTGCCCACCCACAAGGTGGGC
AGCATGGACTGGCAGCAGTACGCCAATTCCGGCCACTTCGACACCTCCAAGCGGCTGTGC
GACTACACCGAGCAGGAGTGGCACACCCTGCTGCACGGCAGCGGCGGCACGGTGACCGTG
CGCACGGCGAACACCACGACCACCCTCGCCTACGAGGGCGTCGTCGCCCGTTTCGCCCGT
ACCAACCTCAAGCGCGACCTGAGCACCCTCGGCGAGCGCGCCCGGGCCAACGTGGAGCGG
TTCGTCTCCCTCGGCCCGTGCACGTCCTGCGGCGGCGCCCGGCTGGCTCCGCCGACCCTG
GCGTCGACGATCGAGGGGCGCACCATCGCCGACCTCTCCCGGATGGAGGTCGGCGAACTC
GTCCCGTTCCTGGAGACGATCACGGACCCGGTGGGGGCGCAGATCGCGGCCGACCTGCGC
GAAGGGCTGAGCCGGGTGGTGGCGATCGGTCTGGGCTACCTGTCCCTGGACCGCTCCTCC
ACCTCACTGTCCGGCGGCGAGGCGCAGCGGCTGAAGATGGTGCGGCACCTCAGCAGCAGC
CTGACGGGCATGACGTACGTCTTCGACGAACCCAGCACCGGTCTGCACCCGCAGGACGTG
GGCAGGCTCGGCGAGTTGATGCGAGCCCTGTGCGACCGGGGCAACACCCTGGTCGTCGTC
GAGCACGACCCGGACGTCATCGCCCTGGCCGACCATGTCGTCGACCTCGGTCCGGGGGCC
GGCCCGCACGGCGGCGAGGTCGTGTACACGGGACCCTTCGGGGGGCTGCTCGGGGCGGAC
ACCGTCACCGGCCGGGCCCTGCGGCGCCGGGGCACGGTCAAGCCGGAGGCCCGGCGGCCC
ACCGGGAAGCTGTCCGTGGAGGGAGCGGACCTGAACAACCTCCGGAACGTGTCCGTCGCC
TTCCCGACCGGGGTGCTGACGGCGGTGACCGGGGTCGCGGGGTCCGGCAAGAGCTCCCTG
GTCACCGGGGCGTTCCGCCAGGCGCACCCGGACGCGGTCTTCGTCGACCAGTCCCCGGTG
CGGGCCTCCGCGCGGTCCACGCCGGTGAGCTTCCTCCAGGCGATGGATCCGCTGCGCAAG
CTGTTCGCCAGGGCCACCGGCGCTCCGGCCGGTCTGTTCAGCTTCAACTCCGCCGGGGCC
TGCGGCACGTGCCAGGGCCGGGGCGAGATCGTCACGGAGCTGGCCTATATGGACCCGGTG
CGGCTGCCCTGCGAGGGGTGCGGGGGCCGCCGGTTCCAGGAGGAGGTGCTCCGGCACCGG
CTGCGCGGCCGGTCCGTCGCGGACGTGCTGGAGATGACCGCGCAGGACGCCCTGGACTTC
TTCACCGAGCCGGAGATCACCGGCCGGATCAGCCGTCTCGTCGACGTCGGGCTGCCGTAC
CTCACCCTAGGCAGGTCGCTGAGCACCCTGTCCGGGGGCGAGCGGCAACGGCTGAAACTG
GCGGGCCAGCTGGAGCGCTCGCACGGCGTGTACGTGCTCGACGAACCGACCACCGGCCTG
CACCGGGCGGACGTGGACGGCCTGGTCGCGCTGCTGGACCGCCTGGTCGACCGGGGCAAC
ACCGTGATCGTCGTGGAACACGACCTGGAGGTGGTGCGGCGCGCGGACTGGGTGGTCGAC
CTCGGTCCCGGCGGCGGCCGGCACGGCGGCGAGGTGGTGTTCACCGGCACACCGGCGGCG
CTGCTGGCCGCCGAGGGGTCGGTCACGGGCGAGCATCTGCGGCGGTTCTGCGCGGGCGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [447-748]  PS50893
PS50893   ABC_TRANSPORTER_2
 [611-678]  4.5e-09 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [32-420]  0.01 SM00382 [483-725]  1.10000029896148e-06 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [650-664]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit