close all open/close all

CDS information : Heda_00060


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction14,511 / 14,164 / - [in whole cluster]
14,511 / 14,164 / - [in contig]
Locationcomplement(14164..14511) [in whole cluster]
complement(14164..14511) [in contig]
TypeCDS
Length348 bp (115 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-12 oxygenase
Product (GenBank)anthrone oxygenase
GenehedQ
Gene (GenBank)
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
  • orf27
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)

close this sectionSequence

selected fasta
>putative C-12 oxygenase [anthrone oxygenase]
MDRNGPPPGAVTFINRFTVTGDPEEFEAAFAKVAAFMTARPGILGHTLSRHLDEPGQYVN
VAVWRDAGSLRAAVAHPDFGAHAGELRRLATSESDVYVERQRHLGGAGGRQGEAV
selected fasta
>putative C-12 oxygenase [anthrone oxygenase]
ATGGACCGCAACGGCCCGCCGCCCGGCGCCGTCACCTTCATCAACCGGTTCACCGTGACC
GGCGACCCCGAGGAGTTCGAAGCCGCCTTCGCCAAGGTGGCCGCCTTCATGACGGCCCGT
CCGGGGATCCTCGGCCACACGCTCTCCCGGCACCTCGACGAGCCCGGCCAGTACGTCAAC
GTCGCCGTGTGGCGCGACGCCGGCTCCCTGCGGGCGGCCGTGGCCCATCCCGACTTCGGC
GCCCACGCCGGCGAACTCCGCCGACTGGCCACCAGTGAGTCCGACGTGTACGTGGAACGG
CAGCGCCACCTCGGCGGGGCCGGCGGCCGGCAGGGCGAGGCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [11-83]  1.6e-18 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-98]  7.60000011115812e-20 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit