close all open/close all

CDS information : Heda_00070


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction15,991 / 14,549 / - [in whole cluster]
15,991 / 14,549 / - [in contig]
Locationcomplement(14549..15991) [in whole cluster]
complement(14549..15991) [in contig]
TypeCDS
Length1,443 bp (480 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)2,3-hexose dehydratase
GenehedP
Gene (GenBank)
EC number
Keyword
  • alpha-L-N,N-dimethylvancosamine
  • beta-D-angolosamine
Note
Note (GenBank)
  • orf26
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [2,3-hexose dehydratase]
MTTHRRKAGTRTPAETAASLAKSAAVRSGPSVGGREARRWLAEQRRRTVMDVRQIPLDRL
TGWHTDPATGDLVHASGRFFAIAGLDVQRPGTPVPSWQQPVIEQPEVGVLGILVREFDGV
LHCLMQAKAEPGNCNRVQLSPTVQATRSNYTRVHEGASVPYLEFFRRPSRHRVLADVRQS
EQGSWFHGKRNRNMVVQVDEDVAVLDGFRWFTLREIHELFAVDDAVNMDTRTVLSCLPYV
GPRLPEVLGTGRDPFTSALLRSCSGLEGGRHGMTEILSWITDERTRTVNEARRVPLKEVA
HWQRRDGRITHASGLFFNVIGVSVTADGREVAAWSQPLLEPCDEGVAAFLAKPVDGVLHV
LVHARAEPGFTDVVELGPTVQCTPSNYAVLPPAARPPFLDEVLHAEAGRVRFDAVHSEEG
GRLYHARNRYVVVETPEDFEPDHCGYRWLTLAQLSRLLRHSNYVNVQARSLVACLYSMTA
selected fasta
>putative NDP-hexose 2,3-dehydratase [2,3-hexose dehydratase]
GTGACGACCCATCGCCGGAAAGCCGGAACCCGGACGCCGGCCGAGACGGCCGCGTCGCTC
GCCAAGTCGGCGGCCGTGCGGTCCGGACCATCGGTCGGCGGCCGGGAAGCCAGGCGCTGG
CTGGCCGAGCAGCGCCGGCGCACGGTGATGGACGTCCGGCAGATACCGCTGGACAGGCTG
ACGGGCTGGCACACCGATCCGGCAACCGGTGACCTCGTGCACGCGTCGGGGAGGTTCTTC
GCGATCGCCGGGCTCGACGTGCAGCGGCCCGGCACTCCCGTGCCGTCCTGGCAGCAGCCG
GTCATCGAGCAGCCCGAGGTGGGTGTGCTGGGCATCCTGGTGCGGGAGTTCGACGGTGTC
CTGCACTGCCTGATGCAGGCCAAGGCGGAGCCCGGCAACTGCAACCGCGTGCAGCTGTCG
CCGACGGTCCAGGCCACCCGCAGCAACTACACGCGGGTGCACGAGGGGGCTTCGGTGCCG
TACCTGGAGTTCTTCCGGCGGCCGTCCCGGCACCGGGTGCTCGCCGACGTGCGGCAGTCG
GAGCAGGGCTCGTGGTTCCACGGCAAGCGCAACCGCAACATGGTGGTACAGGTGGACGAG
GACGTGGCGGTCCTCGACGGTTTCCGCTGGTTCACCCTTCGCGAGATCCACGAGCTGTTC
GCCGTCGACGACGCCGTCAACATGGACACCCGCACGGTCCTGTCCTGCCTGCCCTACGTC
GGTCCGCGGCTGCCGGAGGTCCTGGGAACGGGCCGGGACCCGTTCACCTCCGCTCTGTTG
CGGTCCTGCTCCGGCCTGGAGGGGGGCCGGCACGGCATGACCGAGATCCTGAGCTGGATC
ACGGACGAGCGGACCCGCACGGTCAACGAGGCGCGGCGCGTCCCGCTGAAGGAGGTGGCG
CACTGGCAGCGCCGGGACGGCCGCATCACCCATGCCAGCGGGCTGTTCTTCAACGTGATC
GGGGTCAGCGTGACCGCCGACGGCCGGGAGGTCGCCGCCTGGTCGCAACCGCTGCTGGAG
CCCTGCGACGAGGGGGTCGCGGCCTTCCTCGCCAAGCCGGTGGACGGGGTGCTGCACGTG
CTGGTGCACGCTCGCGCCGAACCCGGTTTCACGGACGTCGTGGAGCTGGGTCCGACCGTG
CAGTGCACTCCGTCGAACTACGCCGTGCTGCCCCCGGCCGCCCGTCCGCCGTTCCTGGAC
GAGGTGCTGCACGCGGAGGCCGGGCGGGTCAGGTTCGACGCGGTGCACTCCGAGGAGGGC
GGCCGCTTGTACCACGCCCGCAACCGCTACGTGGTCGTGGAGACCCCCGAGGACTTCGAA
CCCGACCACTGCGGATACCGCTGGCTGACCCTGGCCCAGCTCTCCCGGCTGCTGCGCCAC
AGCAACTACGTCAACGTGCAGGCCCGCAGCCTGGTGGCCTGCCTGTACAGCATGACCGCT
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [36-237]  3.10000000000005e-84 PF03559 [272-475]  9.10000000000013e-85 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit