close all open/close all

CDS information : Heda_00080


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction16,993 / 16,172 / - [in whole cluster]
16,993 / 16,172 / - [in contig]
Locationcomplement(16172..16993) [in whole cluster]
complement(16172..16993) [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative hydroxylase
GeneorfH10
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf25
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [putative hydroxylase]
MTIFVSGATGNVGRPLVNQLLAAGHPVRALTRDPAKANLPEGAEVVAGNLAVTSTLPDAF
EGVTAAHLISFGDDYAPLSNGPEIAGTAVKAGVRKVTVLKGDTERTGLDEAVEASGLEYT
YLAPVEFMSNTLEWADSVRSEGVVREGFPDIPSSMVHDADIASVAATVLTGEGHAGKEYW
LTGPQALTAPQKVAVLSEVLGREIRFVELSKDEMVAAWREQGYSDEDIEFFVTMRTDPPE
AGRTVLPTVEQVTGQPARTFAQWVRENAAAFGS
selected fasta
>hypothetical protein [putative hydroxylase]
ATGACCATCTTCGTCTCCGGCGCCACCGGCAACGTGGGCCGCCCCCTCGTCAACCAGCTA
CTGGCCGCCGGACACCCGGTCCGGGCCCTGACCCGCGACCCCGCCAAGGCGAACCTCCCG
GAGGGCGCGGAGGTGGTGGCCGGCAACCTGGCCGTCACGTCGACGCTGCCGGACGCCTTC
GAAGGAGTGACCGCGGCGCACCTGATCAGTTTCGGGGACGACTACGCGCCCCTGTCCAAC
GGTCCGGAGATCGCCGGGACCGCGGTGAAGGCCGGGGTGCGCAAGGTGACCGTCCTGAAG
GGCGACACGGAGCGGACCGGGTTGGACGAAGCGGTGGAGGCGAGCGGTCTGGAGTACACC
TACCTCGCCCCGGTGGAGTTCATGTCGAACACCCTGGAATGGGCGGACAGCGTGCGCTCC
GAGGGGGTGGTGCGGGAGGGCTTCCCGGACATCCCCAGCTCGATGGTGCACGACGCGGAC
ATCGCTTCGGTCGCGGCCACGGTGCTGACCGGCGAGGGGCACGCCGGCAAGGAGTACTGG
TTGACCGGTCCCCAGGCCCTGACCGCCCCGCAGAAGGTGGCCGTGCTCAGCGAGGTGCTG
GGCCGGGAGATCCGGTTCGTGGAGCTGAGCAAGGACGAGATGGTCGCGGCCTGGCGCGAG
CAGGGCTACTCGGACGAGGACATCGAGTTCTTCGTGACGATGCGCACCGATCCCCCGGAG
GCGGGCCGCACCGTGCTGCCGACGGTGGAGCAGGTCACCGGACAGCCCGCGCGCACCTTC
GCCCAGTGGGTCCGGGAGAACGCGGCCGCCTTCGGATCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-66]  6.79999999999998e-30 G3DSA:3.40.50.720 [108-205]  6.79999999999998e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit