close all open/close all

CDS information : Heda_00100


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction18,735 / 18,085 / - [in whole cluster]
18,735 / 18,085 / - [in contig]
Locationcomplement(18085..18735) [in whole cluster]
complement(18085..18735) [in contig]
TypeCDS
Length651 bp (216 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ACP-phosphodiesterase
GeneorfH8
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • orf23
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
P41407
PmId
[11583992] Putative ACP phosphodiesterase gene (acpD) encodes an azoreductase. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>putative oxidoreductase [ACP-phosphodiesterase]
MARLLHIDSSSARDSVSRALAVRFREVWDKEHGPDSVTYRDLVADPVPHLDGDAVVTLWS
EPYTEAQRATATLQNRLVEEILAADALLVSVPMYNWTVPSGLKAWLDQSLILGRTLPYDP
GHKPLGGRPATVLTACGGYYGADVPEASMDHCRPYLATVLGQVLGYDLETITVWRTLATA
GQGDARERRAAEESLRAGQEAAQARARAVAASFGEV
selected fasta
>putative oxidoreductase [ACP-phosphodiesterase]
ATGGCCCGACTGCTGCACATCGACTCGTCCTCCGCCCGGGACTCCGTCTCCCGCGCGCTC
GCCGTCCGCTTCCGTGAGGTGTGGGACAAGGAACACGGGCCCGACTCCGTGACCTACCGC
GACCTGGTCGCCGACCCCGTCCCGCACCTCGACGGGGACGCGGTCGTCACCCTGTGGTCC
GAGCCGTACACCGAAGCCCAGCGGGCGACGGCGACGCTGCAGAACCGGCTGGTGGAGGAG
ATCCTGGCCGCGGACGCGCTGCTGGTCAGCGTGCCGATGTACAACTGGACCGTGCCCTCG
GGGCTCAAGGCGTGGCTGGACCAGTCGCTGATCCTGGGCCGCACCCTGCCCTACGACCCG
GGCCACAAGCCGCTGGGCGGGCGCCCGGCGACCGTGCTGACGGCCTGCGGCGGCTACTAC
GGCGCGGACGTGCCGGAGGCGTCCATGGACCACTGCCGTCCCTACCTCGCCACCGTGCTG
GGTCAGGTGCTCGGCTACGACCTGGAGACGATCACGGTGTGGCGCACCCTGGCCACCGCA
GGCCAGGGCGACGCGCGGGAGCGCCGGGCGGCCGAGGAGTCGCTGCGCGCCGGCCAGGAG
GCGGCTCAGGCCCGGGCCCGCGCGGTGGCGGCCTCGTTCGGCGAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003680 Flavodoxin-like fold (Domain)
 [3-182]  1.9e-30 PF02525
PF02525   Flavodoxin_2
IPR023048 NADH-azoreductase, FMN-dependent (Family)
 [2-210]  24.671 MF_01216
MF_01216   Azoreductase_type1
SignalP
 [1-21]  0.128 Signal
Eukaryota   
TMHMM No significant hit