close all open/close all

CDS information : Heda_00110


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction19,562 / 18,843 / - [in whole cluster]
19,562 / 18,843 / - [in contig]
Locationcomplement(18843..19562) [in whole cluster]
complement(18843..19562) [in contig]
TypeCDS
Length720 bp (239 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N,N-dimethyltransferase
Product (GenBank)putative N,N-dimethyltransferase
GenehedO
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • orf22
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose N,N-dimethyltransferase [putative N,N-dimethyltransferase]
MYGADSARFYEAQHTARGKDYRAEAEVVAEHVLRLRPGASSVLDVACGTGGHLDPFGELI
GHVEGVDLSEPMLAIARHKHPGVALHLGDMRDFRLGRVFDVVTCLFASIGYVRSAAELDR
TLACLARHTAEGGVVAVEPWWFPQTYLDRWVSADTVKWEDTTVARVAHTVRDGDASRMEV
HYLEATPEGGVRHLTEVHRAMLFTRERYEEGFRRAGLEPRYVPEVLSGRGLFLGVRPGR
selected fasta
>putative NDP-hexose N,N-dimethyltransferase [putative N,N-dimethyltransferase]
ATGTACGGCGCCGACTCGGCACGGTTCTACGAGGCGCAGCACACCGCGCGGGGCAAGGAC
TACCGGGCCGAGGCCGAGGTGGTCGCGGAGCATGTCCTGCGCCTGCGTCCCGGTGCTTCC
TCGGTCCTCGACGTGGCCTGCGGAACGGGCGGGCACCTGGATCCGTTCGGCGAGCTGATC
GGGCACGTGGAGGGCGTCGATCTGTCCGAGCCGATGCTGGCGATCGCCCGGCACAAGCAT
CCCGGCGTGGCGCTGCACCTCGGCGACATGCGCGACTTCCGGCTGGGTCGGGTCTTCGAC
GTGGTCACCTGCCTGTTCGCCTCCATCGGCTACGTGCGGTCCGCCGCCGAACTGGACCGG
ACGCTGGCCTGCCTCGCCCGGCACACGGCGGAGGGCGGAGTGGTGGCGGTCGAGCCGTGG
TGGTTCCCGCAGACGTATCTGGACCGGTGGGTCAGCGCGGACACGGTGAAGTGGGAGGAC
ACCACCGTGGCCCGGGTGGCGCACACCGTGCGCGACGGCGACGCCTCGCGCATGGAGGTG
CACTACCTGGAGGCCACTCCCGAGGGCGGGGTGCGGCATCTCACCGAGGTGCACCGGGCG
ATGCTGTTCACCCGGGAACGCTACGAAGAGGGCTTCCGCCGGGCCGGGCTGGAGCCGCGG
TACGTCCCGGAGGTGCTGTCGGGGCGGGGGCTGTTCCTGGGGGTGCGCCCCGGGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-41]  0.044 Signal
Bacteria, Gram-positive   
TMHMM No significant hit