close all open/close all

CDS information : Heda_00120


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction19,783 / 20,748 / + [in whole cluster]
19,783 / 20,748 / + [in contig]
Location19783..20748 [in whole cluster]
19783..20748 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)diphospho-4-keto-2,3,6-trideoxyhexulose reductase
GenehedN
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf21
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [diphospho-4-keto-2,3,6-trideoxyhexulose reductase]
MPAQPSALVLGGTGFVGRHVCEGLDRSGFDVVAVARRPPADSVGDRFRPLDLGRQPVGEV
AAVLAETSPAVVVNAVGSIWGHSDPEMWDAAAAPTLRLLDALALSGARPRVIHLGSVLEY
GRVEAGTTMGAATAARPTSAYGRAKLAATRAVLDRVRAGRFDGMVLRAANLAGPGSPDVS
LLGRVATRLAQAGPDGVARVELDPLLARRDYVDVRDVADAVVAAATTSLSGELVDIGRGE
SVPVRTLVDLLIARSGVPARVVERPGAGIRHSTEEWSRVDIAPAARLLGWRPRRSLAEAV
EDFWHDFLRRHHTTDQKRSAH
selected fasta
>putative NDP-hexose C-4 ketoreductase [diphospho-4-keto-2,3,6-trideoxyhexulose reductase]
ATGCCTGCTCAGCCCAGCGCTCTGGTACTCGGCGGCACAGGCTTCGTGGGACGGCACGTG
TGCGAGGGACTCGACAGGAGCGGTTTCGACGTCGTCGCCGTGGCCCGCAGACCGCCCGCC
GATTCCGTGGGCGACCGGTTCCGTCCCCTCGACCTCGGCCGGCAGCCGGTCGGGGAGGTG
GCCGCCGTGCTGGCCGAGACCTCCCCCGCGGTGGTCGTCAACGCGGTCGGCAGCATCTGG
GGACACAGCGACCCGGAGATGTGGGACGCGGCCGCGGCGCCGACCCTGCGGCTCCTCGAC
GCACTCGCGCTGTCCGGCGCACGGCCCCGTGTGATCCACCTGGGATCGGTCCTGGAGTAC
GGGCGGGTCGAGGCCGGCACCACCATGGGCGCCGCCACTGCCGCCCGTCCGACCAGTGCG
TACGGGCGCGCCAAGCTGGCGGCGACCCGAGCCGTCCTGGACCGGGTGCGCGCCGGCCGG
TTCGACGGCATGGTGCTGCGGGCAGCGAACCTGGCCGGTCCGGGCAGCCCGGACGTGAGC
CTGCTCGGCCGGGTGGCCACCCGGCTGGCGCAGGCCGGCCCGGACGGCGTGGCCCGGGTG
GAGCTGGACCCGCTGCTGGCCCGCCGGGACTACGTCGACGTGCGGGACGTCGCCGACGCG
GTGGTGGCCGCCGCCACCACCTCGCTCTCCGGCGAGCTGGTCGACATCGGCAGAGGAGAG
AGCGTGCCCGTGCGCACGCTCGTGGACCTGCTCATCGCCCGCAGCGGGGTGCCCGCCCGT
GTCGTCGAACGGCCGGGCGCCGGCATCCGGCACTCCACCGAGGAGTGGTCCCGGGTGGAC
ATCGCTCCGGCCGCGCGGCTGCTCGGCTGGCGGCCGCGGCGCTCCCTCGCGGAGGCGGTG
GAGGACTTCTGGCACGACTTCCTACGGCGACACCACACGACCGACCAGAAACGGAGCGCA
CACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [7-237]  3.7e-35 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [7-213]  5.80000000000004e-29 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-23]  0.67 Signal
Eukaryota   
TMHMM No significant hit