close all open/close all

CDS information : Heda_00130


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction20,750 / 21,868 / + [in whole cluster]
20,750 / 21,868 / + [in contig]
Location20750..21868 [in whole cluster]
20750..21868 [in contig]
TypeCDS
Length1,119 bp (372 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 aminotransferase
Product (GenBank)aminotransferase
GenehedM
Gene (GenBank)
EC number2.6.1.-
Keyword
  • alpha-L-N,N-dimethylvancosamine
  • beta-D-angolosamine
Note
Note (GenBank)
  • orf20
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q2PC67
NITE
Rubra_00230
PmId
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 aminotransferase [aminotransferase]
MTVHVWDYLPEYEAEREDLLDAVDTVFRSGRLILGDAVSGFERKFAAYHGLAHCTGVDNG
TNAVKLGLEALGVGPGDEVITVSNTAAPTVVAIDGAGATPVFVDVREDDFLMDTDQVAAA
VTPRTRALLPVHLYGQCVDMAPLRELARRHDLVILEDCAQAHGARHHGRLAGTMGDAAAF
SFYPTKVLGAYGDAGAVLTDSAETDARLRRLRYYGMAERYYVVQTPGHNSRLDEVQAEIL
RRKLRRLDDYVRGRRAVAARYAEELGDLAERGLVLPSTAEGNDHVHYVYVVRHPRRDEII
EGMRRYGISLNISYPWPVHTMSGFAHLSRAPGTLPVTERLAKEIFSLPMYPSLPASVQDK
VVAALREVILAL
selected fasta
>putative NDP-hexose C-3 aminotransferase [aminotransferase]
ATGACCGTCCACGTCTGGGACTACCTGCCCGAGTACGAGGCCGAACGGGAAGACCTGCTC
GACGCCGTCGACACCGTCTTCCGATCCGGCCGGCTGATCCTGGGGGACGCCGTCAGCGGC
TTCGAGAGGAAGTTCGCCGCCTACCACGGACTGGCCCACTGCACCGGCGTCGACAACGGC
ACCAACGCCGTCAAGCTCGGTCTCGAAGCCCTGGGCGTCGGACCCGGCGACGAGGTGATC
ACGGTGTCCAACACGGCGGCCCCCACCGTGGTCGCCATCGACGGCGCCGGCGCGACCCCT
GTCTTCGTCGACGTCCGCGAGGACGACTTCCTGATGGACACCGACCAGGTGGCGGCCGCC
GTCACGCCCCGCACCCGTGCCCTGCTGCCCGTGCACCTGTACGGCCAGTGCGTCGACATG
GCGCCGCTGCGCGAGCTCGCCCGCCGCCACGACCTGGTGATCCTGGAGGACTGCGCCCAG
GCCCACGGCGCCCGGCACCACGGCCGGCTCGCCGGCACCATGGGGGACGCCGCCGCGTTC
TCCTTCTACCCGACCAAGGTGCTCGGCGCCTACGGCGACGCCGGCGCGGTCCTCACCGAC
TCGGCGGAGACCGACGCCCGGCTGCGCCGGCTGCGGTACTACGGCATGGCCGAGCGGTAC
TACGTTGTGCAGACCCCGGGGCACAACAGCCGGCTCGACGAGGTGCAGGCCGAGATCCTG
CGCCGCAAACTGCGCCGGCTGGACGACTACGTTCGCGGGCGCCGGGCGGTGGCCGCCCGC
TACGCCGAGGAACTGGGGGACCTGGCCGAGCGGGGCCTGGTGCTGCCGTCCACCGCCGAG
GGCAACGACCACGTCCACTACGTCTACGTGGTCCGCCACCCCCGCCGGGACGAGATCATC
GAGGGGATGAGGCGCTACGGCATCTCGCTCAACATCAGCTATCCCTGGCCGGTGCACACC
ATGTCGGGTTTCGCGCACCTGAGCCGCGCCCCGGGCACGCTGCCGGTGACCGAGCGGCTC
GCGAAGGAGATCTTCTCGCTGCCGATGTATCCCTCGTTGCCGGCGAGCGTCCAGGACAAG
GTCGTCGCCGCGCTGCGCGAGGTGATCCTCGCCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [15-366]  1.9e-116 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-372]  1.90000694315261e-95 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-246]  2.30000000000004e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-369]  1.70000000000001e-34 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [6-369]  6.40004254961849e-103 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit