close all open/close all

CDS information : Heda_00140


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction23,109 / 21,967 / - [in whole cluster]
23,109 / 21,967 / - [in contig]
Locationcomplement(21967..23109) [in whole cluster]
complement(21967..23109) [in contig]
TypeCDS
Length1,143 bp (380 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative C-glycosyltransferase
Product (GenBank)glycosyltransferase
GenehedL
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf19
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9ZGC0
NITE
Lando_00200
PmId
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)
ACC
Q9RPA7
NITE
Urd_00200
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>putative C-glycosyltransferase [glycosyltransferase]
MRFLFVTGGGSAPVHAGIPLAWAARSAGHEVLVACPRENADLVAGLGLPAYTVTDLGMGD
AILKDRQGEWLPMPVGEEEQMDFAGRGFARLSAACLPGTLALAESWRPDVVVGGEYNHAA
HLVAHRFGLPLVSHTWAIYDRTDVDWQGATAELEPELSALGLSAIPAPAVFLDITPPSVR
PGHAVPAEPMRWTPGNQQVPLEPWMCVRGDRPRVVVTSGSRSMFVPTLGVEFFRPLLENP
ALGGGDVEVVVATSPAVAGQLRETWPHVRAGYVPLDVLAPTADLVVHHGGGVTVMTLLNS
GVPQLVLPEIPASAIPLRRVDEYGASLTMATVDESPEAVAAAMSKLLTDPSYRERAGELA
REIARMPAPAQVVERLESAA
selected fasta
>putative C-glycosyltransferase [glycosyltransferase]
ATGCGATTCCTGTTCGTCACCGGTGGCGGATCCGCGCCCGTCCACGCCGGCATTCCCCTG
GCCTGGGCGGCCCGCAGCGCCGGACACGAGGTGCTGGTGGCCTGTCCGCGCGAGAACGCG
GACCTGGTCGCCGGGCTGGGACTGCCCGCGTACACGGTCACCGACCTGGGCATGGGCGAC
GCCATCCTCAAGGACCGGCAGGGCGAGTGGCTGCCCATGCCCGTCGGCGAGGAGGAGCAG
ATGGACTTCGCCGGCCGCGGTTTCGCCCGGCTCTCCGCCGCCTGTCTGCCCGGCACACTG
GCCCTCGCCGAGTCCTGGCGGCCGGACGTGGTGGTCGGCGGCGAGTACAACCACGCCGCC
CACCTGGTCGCCCATCGGTTCGGGCTGCCCCTGGTGAGCCACACCTGGGCCATCTACGAC
CGCACCGACGTCGACTGGCAGGGCGCGACCGCCGAACTGGAGCCGGAGCTGTCCGCACTG
GGCCTCTCGGCGATCCCGGCACCGGCCGTGTTCCTGGACATCACCCCGCCCAGCGTGCGG
CCCGGGCACGCCGTGCCGGCCGAGCCGATGCGCTGGACCCCCGGCAACCAGCAGGTTCCG
CTGGAGCCGTGGATGTGCGTGCGCGGCGACCGGCCGCGCGTGGTCGTCACCTCGGGTTCC
CGCAGCATGTTCGTGCCGACGCTGGGCGTGGAGTTCTTCCGGCCGCTGCTGGAGAACCCG
GCGCTCGGCGGGGGCGACGTCGAGGTGGTCGTCGCCACGTCGCCGGCGGTGGCCGGTCAG
CTGCGGGAGACCTGGCCGCATGTGCGGGCCGGGTACGTGCCGCTCGACGTGCTGGCCCCC
ACGGCCGACCTGGTGGTGCACCACGGCGGGGGCGTCACGGTGATGACCCTGCTGAACTCT
GGGGTGCCGCAACTGGTCCTTCCCGAGATCCCGGCCTCGGCGATCCCGCTGCGCCGGGTC
GACGAGTACGGCGCCTCACTCACCATGGCGACCGTCGACGAGTCCCCGGAAGCGGTCGCG
GCGGCGATGTCGAAGCTGCTCACCGACCCGTCCTACCGGGAGCGGGCCGGTGAACTGGCC
CGGGAGATCGCCCGGATGCCCGCGCCCGCCCAGGTCGTGGAGCGGCTGGAGTCGGCGGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [281-360]  7.80000000000001e-05 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-136]  2.5e-07 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-269]  1.7e-14 PF06722
PF06722   DUF1205
SignalP
 [1-16]  0.937 Signal
Bacteria, Gram-negative   
 [1-16]  0.944 Signal
Eukaryota   
 [1-23]  0.399 Signal
Bacteria, Gram-positive   
TMHMM No significant hit