close all open/close all

CDS information : Heda_00150


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction23,954 / 23,172 / - [in whole cluster]
23,954 / 23,172 / - [in contig]
Locationcomplement(23172..23954) [in whole cluster]
complement(23172..23954) [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter permease protein
Product (GenBank)ABC transporter
GeneorfH7
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf18
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9F5K3
NITE
Avil_00360
PmId
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)
ACC
P32011
NITE
Adria_00140
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter permease protein [ABC transporter]
MSDALTLSRRSLVKNLRNPDVVVFSSAAPIAFALLFGYVFGSAIDLGGPNYREFMVVGIL
TQTMLLTASNTGTGIAYDMKQGLVDRFRSLPISQSAVLFGRTNGDAVNNLVVMALLSVTG
LLMGWRIRGSFADAALAYLLLFLFAYAASWIAATIGLSVRSPEVLGNVLLMALLPLTFVS
NAFVPSDELPGPMRVIAEWNPVSTVVAACRELFGNIPPGWPEPDAWPLQHPVAASFLWVA
VILLVFVPLAIRRYQRAVSQ
selected fasta
>putative drug resistance ABC transporter permease protein [ABC transporter]
GTGAGCGACGCCCTCACCCTGAGCCGGCGCAGCCTGGTCAAGAACCTGCGCAACCCTGAC
GTCGTCGTGTTCTCCAGCGCGGCCCCCATCGCCTTCGCCCTGCTCTTCGGCTATGTCTTC
GGCAGCGCGATCGACCTGGGCGGCCCGAACTACCGCGAGTTCATGGTGGTCGGCATCCTC
ACCCAGACGATGCTGCTCACCGCCTCCAACACCGGCACGGGCATCGCCTACGACATGAAG
CAGGGCCTGGTGGACCGCTTCCGGTCGCTGCCCATCTCCCAGTCCGCGGTGCTCTTCGGC
CGGACCAACGGCGACGCCGTGAACAACCTCGTGGTGATGGCGCTGCTGTCGGTGACCGGC
CTGCTGATGGGCTGGCGGATCCGCGGCTCGTTCGCGGACGCGGCCCTGGCCTATCTGCTC
CTGTTCCTGTTCGCGTACGCCGCGTCCTGGATCGCGGCGACGATCGGCCTGAGCGTCCGC
TCCCCCGAAGTGCTCGGCAACGTGCTGCTGATGGCACTGCTGCCGCTGACCTTCGTGTCC
AACGCCTTCGTGCCCAGCGACGAACTGCCCGGCCCGATGCGCGTGATCGCGGAGTGGAAC
CCGGTCTCCACGGTCGTCGCGGCCTGCCGCGAACTCTTCGGCAACATCCCGCCCGGCTGG
CCCGAGCCGGACGCGTGGCCGCTGCAGCACCCGGTTGCGGCGTCCTTCCTGTGGGTGGCG
GTCATCCTGCTGGTCTTCGTACCGCTGGCCATCCGCCGCTACCAACGGGCCGTCAGTCAG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [20-257]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [5-211]  1.5e-27 PF01061
PF01061   ABC2_membrane
SignalP
 [1-27]  0.441 Signal
Bacteria, Gram-positive   
 [1-41]  0.504 Signal
Bacteria, Gram-negative   
 [1-41]  0.301 Signal
Eukaryota   
TMHMM
 [21-40]  Transmembrane (i-o) [55-77]  Transmembrane (o-i) [106-125]  Transmembrane (i-o) [135-157]  Transmembrane (o-i) [164-186]  Transmembrane (i-o) [232-251]  Transmembrane (o-i)
Transmembrane 6