close all open/close all

CDS information : Heda_00160


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction24,976 / 23,972 / - [in whole cluster]
24,976 / 23,972 / - [in contig]
Locationcomplement(23972..24976) [in whole cluster]
complement(23972..24976) [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter ATP-binding protein
Product (GenBank)ATP-binding protein
GeneorfH6
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf17
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9F5K4
NITE
Avil_00350
PmId
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)
ACC
P32010
NITE
Adria_00130
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
[25721665] Characterization of a novel domain 'GATE' in the ABC protein DrrA and its role in drug efflux by the DrrAB complex. (Biochem Biophys Res Commun. , 2015)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter ATP-binding protein [ATP-binding protein]
MTHAILAEGLSRRFGSTRALDGLDLAVREGSVMSLLGPNGSGKTTTVRVLSTLLRPDSGR
ATVAGLDVLKDMVKLRRKIGLSGQYAAVDEDLTARENLRMVGRLYHLGASAANRRADELL
ERFGLASEADRQVGGYSGGMRRRVDLACAVISRPEVLFLDEPTTGLDVRSRRALWAVISE
LVGEGSTLLLTTQYLEEADELSDAITVVDRGRVIAEGTPDELKARVGSDRLELTLANAED
LATARRLLAGIAEGDITADEKETQLVVPVGDGSEALVAAIRRLDGEGLGLVGAGLRRPTL
DEAFLVLTEDLSTGPHGEAADAEHGGAAQKEHTR
selected fasta
>putative drug resistance ABC transporter ATP-binding protein [ATP-binding protein]
ATGACACACGCGATCCTCGCCGAAGGCCTGTCACGGCGATTCGGCTCCACGCGCGCATTG
GACGGCCTGGACCTGGCAGTCCGCGAGGGGTCGGTGATGAGCCTCCTGGGACCCAACGGG
TCCGGGAAGACCACGACCGTGCGGGTGCTGTCCACCCTGTTGCGCCCGGATTCCGGGCGG
GCCACGGTGGCCGGCCTCGACGTGCTGAAGGACATGGTGAAGCTGCGCCGCAAGATCGGC
CTGTCCGGCCAGTACGCCGCCGTGGACGAGGATCTCACCGCCCGGGAGAACCTGCGCATG
GTCGGCAGGCTTTACCACCTGGGCGCCTCGGCGGCCAACCGGCGGGCCGACGAACTGCTC
GAGCGGTTCGGCCTGGCCTCCGAGGCCGACCGTCAGGTCGGAGGCTACTCCGGCGGCATG
CGCCGCCGCGTCGACCTGGCCTGCGCGGTGATCTCCCGGCCCGAGGTCCTCTTCCTCGAC
GAGCCCACGACCGGACTGGACGTGCGCAGCCGGCGCGCGCTGTGGGCGGTGATCTCCGAG
CTGGTCGGCGAGGGGAGCACCCTGCTGCTCACCACCCAGTACCTGGAGGAGGCCGACGAG
CTCTCCGACGCGATCACGGTCGTCGACCGGGGCCGCGTCATCGCCGAGGGCACCCCGGAC
GAGCTGAAGGCGCGCGTCGGCAGCGACCGCCTGGAACTGACACTGGCGAACGCCGAGGAC
CTCGCCACCGCGCGCCGCCTGCTGGCCGGCATCGCGGAGGGCGACATCACGGCGGACGAG
AAGGAGACCCAGCTCGTCGTGCCCGTCGGCGACGGATCCGAGGCGCTGGTCGCGGCGATC
CGCCGGCTGGACGGCGAGGGCCTCGGACTGGTCGGCGCGGGCCTGCGCCGGCCGACCCTC
GACGAGGCGTTCCTGGTACTCACCGAGGACCTCTCCACCGGCCCGCACGGCGAGGCCGCA
GACGCGGAGCACGGCGGCGCGGCGCAGAAGGAGCACACGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [44-164]  1.99999999999999e-20 PF00005
PF00005   ABC_tran
 [5-235]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [29-212]  2.59999946718995e-12 SM00382
SM00382   AAA
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [13-308]  3.90000000000001e-104 TIGR01188
TIGR01188   DrrA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [136-150]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit