close all open/close all

CDS information : Heda_00180


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction28,587 / 27,493 / - [in whole cluster]
28,587 / 27,493 / - [in contig]
Locationcomplement(27493..28587) [in whole cluster]
complement(27493..28587) [in contig]
TypeCDS
Length1,095 bp (364 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneorfH4
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf15
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MQLGLTRHSLNRATLARQSLLARTDSTPLEVITLLAGLQAQDPEPPYYGLWNRIDNFHQD
DLTRLLEERRVVRSTLYRGTQHLVTAEDYVWLRPALQPMLDRWQRGAWGKVTAGIDLSEL
AGAVRELLGDGQLSRPELAAALADRWPGRDPVGLARSAQALLAIVHPAPDGTWGRRGTTP
FMLAEQWLGRPLAADPPVDRLVLRHLAAFGPATVRDVQAWSGMTRLREVVDRLRPELKVF
HGSEGQELFDLPDAPRPGPDVPAPVRFLALLDNVVLAYADRTRMLSDDRRVPVSLEPALS
VNGFVHGLWRVRRDRGSRAVLRIKLFEPLPPGAEADVTEEGTRLLRFAAPDAGAYDIEIR
DGWR
selected fasta
>hypothetical protein [hypothetical protein]
ATGCAGCTCGGTCTCACGCGCCACTCCCTCAACAGGGCGACCCTGGCCCGCCAGTCGTTG
CTCGCCCGCACCGACAGCACCCCCCTGGAGGTGATCACCCTGTTGGCGGGTCTCCAGGCG
CAGGATCCGGAGCCGCCGTACTACGGACTGTGGAACCGGATCGACAACTTCCACCAGGAC
GACCTGACCCGCCTGCTGGAGGAACGCCGGGTGGTCCGCTCGACGCTGTACCGGGGGACG
CAGCACCTGGTCACGGCCGAGGACTACGTCTGGCTCCGGCCGGCACTCCAGCCCATGCTG
GATCGCTGGCAGCGGGGCGCCTGGGGCAAGGTGACCGCCGGCATCGACCTGTCGGAACTG
GCGGGGGCCGTGCGCGAGCTGCTCGGCGACGGGCAGTTGTCACGGCCCGAGCTCGCCGCC
GCGCTGGCCGACCGATGGCCGGGCCGCGACCCGGTGGGCCTCGCCCGCTCGGCCCAGGCC
CTGCTGGCCATCGTCCACCCGGCGCCGGACGGGACGTGGGGGCGCCGCGGCACGACCCCG
TTCATGCTCGCCGAGCAGTGGCTGGGCCGGCCGCTGGCCGCCGACCCTCCGGTGGACCGC
CTGGTGCTGCGCCATCTCGCGGCCTTCGGTCCGGCCACCGTGCGGGACGTGCAGGCGTGG
AGCGGCATGACACGGCTGCGCGAGGTGGTGGACCGACTGCGGCCGGAGCTAAAGGTCTTT
CACGGTTCCGAGGGACAGGAGCTGTTCGACCTGCCCGACGCCCCGAGGCCGGGGCCGGAC
GTCCCCGCTCCGGTCCGCTTCCTGGCCCTCCTCGACAACGTGGTGCTGGCCTACGCCGAC
CGCACCCGGATGCTCAGCGACGACCGGCGCGTGCCGGTCAGTCTCGAACCCGCCCTGAGC
GTGAACGGGTTCGTGCACGGACTGTGGCGGGTCCGGCGTGACAGGGGCTCCCGCGCGGTG
CTCCGGATCAAGCTGTTCGAGCCGCTTCCGCCCGGCGCGGAGGCAGACGTCACGGAGGAG
GGCACACGCCTGCTGCGCTTCGCGGCGCCGGACGCCGGGGCGTACGACATCGAGATCCGC
GACGGATGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009351 Protein of unknown function DUF1006 (Family)
 [12-347]  7.90000000000016e-70 PF06224
PF06224   DUF1006
SignalP
 [1-40]  0.197 Signal
Eukaryota   
TMHMM No significant hit