close all open/close all

CDS information : Heda_00190


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction28,743 / 29,423 / + [in whole cluster]
28,743 / 29,423 / + [in contig]
Location28743..29423 [in whole cluster]
28743..29423 [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)putative 3-5-epimerase
GenehedK
Gene (GenBank)
EC number5.1.3.-
Keyword
  • alpha-L-N,N-dimethylvancosamine
Note
Note (GenBank)
  • orf14
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [putative 3-5-epimerase]
MQTRSLKVAGVLEFSPPVFRDPRGLFVSPFQRDAFVAATGHELFGVAQTSFSVSRRGAVR
GIHYTRVPPGTAKYVHCPRGRALDMVVDLRLGSPTFGAWDSVVLDQDDCRALYLPVGVGH
AFAALTDDTLMAYTLSTAYAPENELAVSVHDPRLRLPLPRDVPPLLSERDRAAPTLAEAA
ARGLLPDYTRCREAEQVLAGAPVPSAGSAGEPGGGPAASPATDATP
selected fasta
>putative NDP-hexose epimerase [putative 3-5-epimerase]
ATGCAGACACGCTCATTGAAGGTGGCCGGAGTCCTGGAGTTCAGCCCGCCCGTGTTCCGC
GATCCACGCGGCCTGTTCGTCTCGCCCTTCCAGCGGGACGCCTTCGTGGCGGCGACCGGG
CACGAGCTGTTCGGCGTCGCGCAGACGAGCTTCAGCGTCTCCCGGCGCGGCGCCGTGCGC
GGCATCCACTACACCCGCGTGCCCCCGGGCACCGCCAAGTACGTCCACTGCCCGCGCGGC
CGGGCGCTCGACATGGTGGTGGACCTGCGGCTCGGATCACCCACCTTCGGCGCCTGGGAC
AGCGTGGTGCTCGACCAGGACGACTGCCGGGCCCTCTACCTGCCGGTGGGAGTGGGACAC
GCCTTCGCCGCACTGACCGACGACACGCTCATGGCGTACACGCTCTCCACCGCGTACGCC
CCGGAGAACGAACTCGCCGTCTCGGTGCACGATCCGCGGCTGCGGCTCCCGCTGCCCCGT
GACGTCCCGCCACTGCTCTCCGAGCGGGACCGCGCGGCTCCCACGCTCGCCGAGGCCGCG
GCACGGGGCCTGCTGCCCGACTACACCCGGTGCCGCGAGGCCGAGCAGGTCCTGGCCGGC
GCACCGGTCCCATCCGCCGGGAGCGCCGGGGAGCCCGGGGGAGGCCCCGCTGCTTCGCCC
GCCACCGACGCCACGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-171]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  1.80000000000002e-51 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-183]  1e-65 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-191]  2.99999999999998e-56 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-36]  0.166 Signal
Bacteria, Gram-negative   
TMHMM No significant hit