close all open/close all

CDS information : Heda_00200


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction29,467 / 30,606 / + [in whole cluster]
29,467 / 30,606 / + [in contig]
Location29467..30606 [in whole cluster]
29467..30606 [in contig]
TypeCDS
Length1,140 bp (379 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative C-glycosyltransferase
Product (GenBank)glycosyltransferase
GenehedJ
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf13
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q70J67
NITE
Chro_00310
PmId
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)
ACC
Q9ZGC0
NITE
Lando_00200
PmId
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)
ACC
Q9RPA7
NITE
Urd_00200
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>putative C-glycosyltransferase [glycosyltransferase]
MKVLVNTGPAHPLFFPLVPLAWALHAAGHHVLVATPESFEPVVRGAGLRMAPVYGPLDMG
EVMGRDREGNRLRVPDSEEEMADGVGCGFARLAVRTLEPTVELVGSWRPDLVIGESYSFA
SAAIAAAVHGVPWVKHTVGPGDLPVTAALARELAPELKEHGLVEMPRPDLVLDNCPPLMG
GPAPDTTPVRYVPYGEPGVVPDWALRPGVRPRVLVTLGSVQPQIGGLPALAEMLAAVAEL
PVDLVVAVADHLVPGLGPLPANVIAAGWQSLTAVLPGCDLAVHHGGPGTMMACSFHGLPQ
VIVPGRGKPLDEIRRLAATGAVTEVPPAELTPHALRDACRTLLDDPGRRERARALRDHIA
EQPSPLRVVGVLEELAAAR
selected fasta
>putative C-glycosyltransferase [glycosyltransferase]
ATGAAGGTTCTGGTCAACACGGGTCCCGCCCACCCGCTGTTCTTCCCCCTGGTGCCGCTC
GCCTGGGCGCTGCACGCGGCCGGCCACCATGTGCTGGTCGCGACCCCGGAGAGCTTCGAG
CCGGTGGTGCGGGGCGCGGGCCTGCGCATGGCCCCGGTGTACGGACCGCTCGACATGGGT
GAGGTCATGGGCCGCGACCGCGAGGGCAACCGGCTGCGGGTCCCGGACTCCGAGGAGGAG
ATGGCCGACGGCGTGGGCTGCGGCTTCGCCCGCCTGGCCGTCCGGACGCTGGAGCCCACC
GTGGAACTGGTCGGTTCCTGGCGGCCCGACCTGGTGATCGGCGAGTCCTACTCGTTCGCC
TCCGCCGCGATCGCCGCCGCCGTCCACGGTGTGCCCTGGGTCAAGCACACGGTCGGACCC
GGCGACCTGCCGGTCACCGCCGCCCTGGCCCGCGAACTCGCTCCCGAGCTCAAGGAGCAC
GGGCTGGTGGAAATGCCGCGCCCCGACCTCGTGCTGGACAACTGCCCGCCCCTGATGGGC
GGCCCGGCCCCGGACACGACCCCCGTGCGGTACGTCCCCTACGGGGAACCCGGTGTGGTC
CCGGACTGGGCACTGCGCCCGGGCGTCCGGCCCCGGGTCCTGGTGACGCTGGGCTCGGTC
CAGCCGCAGATCGGCGGTCTGCCGGCGCTCGCCGAGATGCTGGCGGCGGTGGCGGAGCTG
CCCGTCGACCTCGTGGTCGCGGTCGCCGACCACCTCGTGCCCGGGCTGGGTCCGCTGCCC
GCCAACGTCATCGCCGCGGGCTGGCAGTCGCTCACCGCCGTCCTGCCCGGCTGCGACCTC
GCCGTGCACCACGGAGGGCCGGGCACCATGATGGCCTGTTCCTTCCACGGGCTGCCCCAA
GTGATCGTCCCCGGTCGCGGCAAGCCGCTGGACGAGATCCGGCGGCTGGCCGCGACCGGC
GCCGTGACCGAGGTTCCGCCCGCGGAGCTGACCCCGCACGCGCTGCGCGACGCCTGCCGG
ACCCTGCTCGACGACCCCGGCCGGCGCGAGCGGGCCCGGGCGCTCCGCGACCACATCGCC
GAGCAGCCGTCGCCCCTGCGCGTCGTCGGCGTGCTCGAGGAACTCGCGGCGGCCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [282-355]  2.9e-05 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [14-138]  6.90000000000001e-10 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-263]  4.70000000000001e-20 PF06722
PF06722   DUF1205
SignalP
 [1-26]  0.405 Signal
Bacteria, Gram-negative   
 [1-23]  0.476 Signal
Bacteria, Gram-positive   
 [1-28]  0.982 Signal
Eukaryota   
TMHMM No significant hit