close all open/close all

CDS information : Heda_00210


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction30,644 / 31,621 / + [in whole cluster]
30,644 / 31,621 / + [in contig]
Location30644..31621 [in whole cluster]
30644..31621 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)probable dTDP-4-keto-6-deoxyhexose reductase
GenehedI
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf12
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [probable dTDP-4-keto-6-deoxyhexose reductase]
MTRRQAAGAGRVAVLGGTGWVGRHVCRAFSRAGHEVLVVARRPAEHRAPHPFVALDLADA
PAGELRRLLADAGAGVVVNATDAANAADGWAVGEQALAALNVDLVERLVTAAGALPWRTR
LVHLGSILEYGETPHGTRVDERYPPRPTTAYTRSKLAGSTAVLDAARAGTVDATVLRLTN
VCGPHPSPQSLPGKLVELLAEAVRSGGPMIVGVTEARRDFVDVRDVAEAVLRAAGPGATG
RAVNIGSGRAVGIRELVRLFVTVAGSDPGILREERRPNTSLGGTWTCADIRLAGELLGWR
PRTGLAASLRDMWRTAARTPDGGRG
selected fasta
>putative NDP-hexose C-4 ketoreductase [probable dTDP-4-keto-6-deoxyhexose reductase]
GTGACACGACGGCAGGCGGCCGGAGCGGGGCGGGTGGCCGTCCTCGGCGGCACCGGCTGG
GTGGGCCGGCACGTGTGCCGGGCGTTCTCCCGCGCCGGTCACGAAGTCCTCGTGGTGGCT
CGCCGCCCCGCCGAGCACCGCGCCCCGCATCCCTTCGTCGCGCTCGACCTCGCCGACGCC
CCGGCCGGCGAGCTGCGCCGGCTGCTGGCCGACGCGGGCGCGGGCGTGGTGGTCAACGCG
ACCGACGCAGCCAACGCCGCCGACGGCTGGGCCGTCGGCGAGCAGGCGCTGGCCGCGCTC
AACGTGGACCTGGTGGAACGGCTCGTCACGGCGGCCGGCGCGCTGCCGTGGCGCACCCGG
CTGGTCCACCTGGGCTCGATCCTCGAGTACGGCGAGACGCCGCACGGCACCCGGGTGGAC
GAGCGCTACCCGCCCCGGCCGACGACCGCCTACACCCGCAGCAAGCTGGCCGGTTCCACG
GCCGTGCTGGACGCGGCGCGCGCCGGCACGGTCGACGCGACGGTGCTGCGCCTGACGAAC
GTCTGCGGCCCCCACCCCTCCCCGCAGAGCCTGCCGGGCAAGCTGGTCGAGCTGCTCGCC
GAGGCGGTGCGCTCGGGCGGTCCCATGATCGTGGGCGTGACCGAGGCCCGACGCGACTTC
GTCGATGTCCGCGACGTCGCGGAGGCGGTGCTCCGCGCCGCCGGGCCGGGGGCGACCGGC
CGCGCCGTCAACATCGGCAGCGGCCGGGCCGTCGGCATCCGCGAGCTGGTACGGCTCTTC
GTCACGGTCGCGGGGAGCGACCCGGGCATCCTGCGCGAGGAACGGCGGCCCAACACCAGC
CTGGGCGGGACCTGGACCTGCGCGGACATCCGGCTCGCCGGTGAACTGCTCGGCTGGCGC
CCGCGCACCGGCCTGGCCGCCTCACTGCGCGACATGTGGCGGACCGCCGCCCGGACACCG
GACGGCGGCCGAGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [13-246]  2.19999999999997e-39 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [11-182]  4.70000000000001e-23 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-28]  0.71 Signal
Eukaryota   
TMHMM No significant hit