close all open/close all

CDS information : Heda_00230


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction33,609 / 32,374 / - [in whole cluster]
33,609 / 32,374 / - [in contig]
Locationcomplement(32374..33609) [in whole cluster]
complement(32374..33609) [in contig]
TypeCDS
Length1,236 bp (411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative monooxygenase
GenehedG
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf10
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9AVE7
PmId
[11244106] Screening of the rice viviparous mutants generated by endogenous retrotransposon Tos17 insertion. Tagging of a zeaxanthin epoxidase gene and a novel ostatc gene. (Plant Physiol. , 2001)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative monooxygenase]
MTRALVVGGGIAGPVAAIALQKAGLDPVVYEAFPRTADTAGNFMNIAPNGLDALACVGLA
EPVRRLGFTTPAIAFYRADGRRLTEDVPVEVQAGPGAVIQTLRRADLYRTLREEVSRRGI
PVEYGRRLVDARASGGRVSARFADGTHAEGELLVGADGIRSRVRKVIDRQAPDPRYLGTV
NAFGVAPGQPLRGRPGVLRMYFGRRSFFMSAQHPDGDVWWFANPPRPAEPDAAELRRPDE
RWQEEFVELFRQDGMPAVDIVRASTQFSVPSANYDLPRVPHWQRDGMVLVGDAAHAVSPT
AGQGGSVAMEDAVVLAKCVRDAPGVDAALAAYERVRRARVERIVAQGKRNVDGNLSGPLG
RVVRDFFIRRAFRDIAVKGPERSPVWMLGHHIDWDTPEAAAPGSRRAGTGR
selected fasta
>putative oxidoreductase [putative monooxygenase]
ATGACACGCGCTCTGGTCGTCGGCGGAGGGATCGCGGGCCCGGTGGCCGCGATCGCCCTG
CAGAAGGCGGGACTCGACCCGGTGGTGTACGAGGCGTTCCCCCGCACCGCGGACACCGCC
GGGAACTTCATGAACATCGCGCCCAACGGCTTGGACGCGCTCGCCTGCGTGGGCCTGGCC
GAGCCGGTACGGCGGCTGGGCTTCACGACGCCGGCGATCGCCTTCTACCGTGCCGACGGA
CGCAGGCTGACCGAGGACGTGCCCGTCGAGGTCCAGGCCGGACCCGGCGCGGTGATCCAG
ACCCTGCGCCGCGCGGACCTCTACCGGACGCTGCGGGAGGAGGTGTCGCGGCGCGGCATC
CCCGTGGAGTACGGCAGGCGTCTGGTCGACGCGCGGGCCTCGGGAGGCCGGGTCAGCGCG
CGGTTCGCGGACGGCACGCACGCCGAGGGCGAACTGCTCGTGGGCGCGGACGGAATCCGG
TCCCGGGTGCGCAAGGTGATCGACCGGCAGGCGCCCGATCCGCGCTACCTCGGCACGGTC
AACGCCTTTGGGGTGGCCCCGGGGCAGCCGCTGCGGGGCCGGCCCGGGGTGCTGCGGATG
TACTTCGGGCGCAGGAGCTTCTTCATGTCGGCGCAGCATCCGGACGGGGACGTGTGGTGG
TTCGCCAATCCGCCCCGCCCGGCCGAGCCGGACGCCGCCGAACTGCGCCGCCCCGACGAG
CGGTGGCAGGAGGAGTTCGTCGAGCTGTTCCGGCAGGACGGGATGCCCGCCGTCGACATC
GTCCGGGCCAGCACCCAGTTCTCCGTGCCGTCGGCCAACTACGACCTGCCCAGGGTGCCG
CACTGGCAGCGCGACGGCATGGTCCTGGTCGGGGACGCCGCCCACGCGGTCTCCCCCACG
GCGGGCCAGGGCGGTTCGGTTGCCATGGAGGACGCGGTGGTCCTCGCCAAGTGCGTGCGG
GACGCGCCGGGCGTCGACGCCGCGCTGGCCGCGTACGAACGGGTGCGCCGCGCCCGCGTG
GAGCGGATCGTGGCCCAGGGCAAACGCAATGTGGACGGCAATCTGAGCGGGCCGCTCGGC
CGGGTGGTGCGCGACTTCTTCATCCGCCGGGCGTTTCGCGACATCGCCGTCAAGGGGCCG
GAGAGAAGCCCCGTGTGGATGCTGGGGCATCACATCGACTGGGACACTCCCGAGGCGGCC
GCGCCCGGGTCGCGCCGGGCGGGGACGGGACGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [2-345]  9.5e-29 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [3-25]  4.40000933643892e-19 PR00420 [149-164]  4.40000933643892e-19 PR00420 [284-299]  4.40000933643892e-19 PR00420 [299-315]  4.40000933643892e-19 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-19]  0.91 Signal
Bacteria, Gram-negative   
 [1-17]  0.948 Signal
Eukaryota   
TMHMM No significant hit