close all open/close all

CDS information : Heda_00240


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction35,231 / 33,606 / - [in whole cluster]
35,231 / 33,606 / - [in contig]
Locationcomplement(33606..35231) [in whole cluster]
complement(33606..35231) [in contig]
TypeCDS
Length1,626 bp (541 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative secreted tripeptidylaminopeptidase
GeneorfH3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf9
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q54410
PmId
[7487044] Cloning and characterization of a gene encoding a secreted tripeptidyl aminopeptidase from Streptomyces lividans 66. (Appl Environ Microbiol. , 1995)

close this sectionSequence

selected fasta
>putative hydrolase [putative secreted tripeptidylaminopeptidase]
MAPSLAGRRRGTPEDGWSAGVESCSTPVRGPGGSLAAMTRDAQPPSSAAFHTQRPTWAPA
PSGDGVEHATVQVPLDYADPAGATLTIAVSRRRATDPARRRGVLLALNGGPGGYFGLGRR
FAQVLAATPLAEVYDLIGFDPRGTGDSTPLHAEITPRRTPVDSRPPESAFPLLAEDARDR
EEGNRRGGGARRPHFSTRNVARDMDVLRAVLGEPVINYLGYTYGTYAGAVYGAMFPERLD
RSVLDSCVHPDWTWREQLMAQGAAHRANVDAWAQWTARRRGHFGLGSSAAEVLDAVERTV
AHVETLPDGVRLRTLLDSALGSRSADRARWSELGRMVGSLAGADGPTAAALLADERIWPP
EETEGATRCGVLDAVILEKDWPDDLETYYADMRRFRARHPYGCGVTRAQPLPGAFRTFTP
PEPPTRLVRDGYPAGLVVHADGDPVDHYPGGVALARRLGHRLVTVADSGQHEIYAFQRNK
QVDEVVEAYLVDGVLPEGDVTCPSTVARPDLPEDDAGGHPDGVGVNALAASADSDREGRH
A
selected fasta
>putative hydrolase [putative secreted tripeptidylaminopeptidase]
GTGGCGCCCAGCCTGGCGGGGAGGCGTCGAGGCACGCCTGAGGACGGTTGGAGCGCCGGG
GTCGAGTCCTGCTCCACGCCTGTTCGAGGCCCAGGCGGCAGTCTCGCCGCCATGACCCGT
GACGCTCAGCCGCCGTCGTCGGCGGCGTTTCACACGCAGCGCCCCACGTGGGCCCCCGCG
CCGTCGGGCGACGGGGTGGAACACGCCACCGTGCAGGTGCCACTCGACTACGCGGACCCC
GCGGGCGCCACCCTGACGATCGCCGTCAGCAGACGCAGGGCCACCGATCCCGCCCGCCGC
CGCGGCGTCCTGCTGGCACTGAACGGCGGGCCGGGCGGCTACTTCGGGCTCGGCCGACGC
TTTGCCCAGGTGCTGGCGGCCACGCCTCTCGCGGAGGTGTACGACCTGATCGGTTTCGAC
CCGCGCGGCACCGGCGACTCCACTCCGCTGCACGCGGAGATCACCCCCCGCCGCACGCCC
GTGGACTCGCGTCCGCCGGAGTCCGCCTTCCCCCTGCTCGCCGAGGACGCGCGCGACCGG
GAGGAGGGGAACCGGCGCGGCGGCGGGGCGCGCCGGCCGCACTTCAGCACCCGCAACGTC
GCCCGGGACATGGACGTCCTGCGCGCGGTGCTCGGCGAGCCCGTCATCAACTACCTGGGC
TACACGTACGGGACGTACGCGGGCGCCGTCTACGGCGCGATGTTCCCCGAGAGGCTGGAC
CGCAGCGTCCTCGACTCCTGTGTGCACCCGGACTGGACCTGGCGCGAGCAACTGATGGCC
CAGGGCGCGGCACACCGGGCGAACGTCGACGCGTGGGCTCAGTGGACGGCCCGACGGCGC
GGGCACTTCGGGCTCGGCTCGTCGGCCGCGGAGGTGCTGGACGCCGTGGAACGGACCGTG
GCGCACGTCGAGACGCTGCCCGACGGGGTGCGGCTGCGCACCCTGCTGGACTCGGCGCTC
GGCTCGCGCTCCGCGGACCGGGCGCGCTGGTCTGAGCTGGGCCGGATGGTGGGTTCGCTG
GCCGGCGCGGACGGTCCCACCGCCGCGGCGCTGCTGGCGGACGAGCGGATCTGGCCGCCG
GAGGAGACGGAGGGCGCGACACGCTGCGGGGTTCTGGACGCCGTCATCCTGGAGAAGGAC
TGGCCGGACGACCTCGAGACGTACTACGCCGACATGCGCCGCTTCCGCGCCCGTCACCCT
TACGGGTGCGGGGTGACGCGGGCCCAGCCGCTGCCCGGCGCGTTCCGCACCTTCACCCCG
CCGGAGCCGCCCACCCGGCTGGTCCGGGACGGCTATCCGGCCGGGCTGGTCGTGCACGCC
GACGGCGACCCCGTCGACCACTACCCGGGCGGCGTGGCGCTGGCCCGGCGACTGGGCCAC
CGGCTGGTGACGGTCGCCGACTCCGGCCAGCACGAGATCTACGCCTTCCAGCGCAACAAG
CAGGTGGACGAGGTCGTCGAGGCGTACCTGGTCGACGGAGTGCTGCCGGAGGGCGACGTC
ACCTGCCCGAGCACCGTTGCCCGCCCGGATCTGCCCGAGGACGACGCCGGCGGGCACCCG
GACGGCGTCGGGGTGAACGCCCTCGCCGCCTCGGCCGACAGCGACCGCGAAGGAAGGCAC
GCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013595 Peptidase S33 tripeptidyl aminopeptidase-like, C-terminal (Domain)
 [405-502]  1.6e-18 PF08386
PF08386   Abhydrolase_4
SignalP No significant hit
TMHMM No significant hit