close all open/close all

CDS information : Heda_00260


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction36,538 / 37,497 / + [in whole cluster]
36,538 / 37,497 / + [in contig]
Location36538..37497 [in whole cluster]
36538..37497 [in contig]
TypeCDS
Length960 bp (319 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productcyclase/dehydratase/polyketide synthase acyl carrier protein subunit
Product (GenBank)putative bifunctional cyclase dehydratase and ACP fusion
GenehedE
Gene (GenBank)
EC number
Keyword
  • 1st ring
  • type II PKS
Note
  • multifunctional protein
Note (GenBank)
  • orf7
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

ACP239..312

close this sectionSequence

selected fasta
>cyclase/dehydratase/polyketide synthase acyl carrier protein subunit [putative bifunctional cyclase dehydratase and ACP fusion]
MGGSWTLEERGEGCTVVLDHHYRAVDDDPARLARIARAVEHNSTVELDNLRRAVLRAGQE
PELLFEFADTETVSGPPEEVYAFLYDAAKWPERIPHVAHVEVREDVLGLQHLRMDTRAPD
GSVHTTVSGRVCEPGRRIVYKQTTLPPVLQAHNGEWLVEETGDGAVRVTARHQVILDPEG
IAGLAEPPESLAAARDAVREALGANSRATMARARAFAEANRPRTPRHHTKGNTAMAELTL
DELKRFLLSAAGDDESVELSGDILHVRLVDLGFDSLAVIDTLGRLERHFGVKLPEEATTE
VETPADLLAAVNRQVAEAA
selected fasta
>cyclase/dehydratase/polyketide synthase acyl carrier protein subunit [putative bifunctional cyclase dehydratase and ACP fusion]
ATGGGCGGCTCCTGGACCTTGGAGGAGCGCGGCGAGGGATGCACCGTCGTCCTCGACCAC
CACTACCGCGCCGTCGACGACGACCCGGCGCGCCTGGCCCGCATCGCGCGGGCCGTGGAG
CACAACAGCACCGTGGAGCTGGACAACCTCCGGCGCGCCGTGCTGCGGGCCGGACAGGAG
CCGGAGCTGCTGTTCGAGTTCGCCGACACCGAGACCGTCTCCGGCCCGCCGGAGGAGGTG
TACGCCTTCCTCTACGACGCCGCGAAATGGCCCGAGCGCATCCCGCACGTCGCGCACGTC
GAGGTACGCGAGGACGTGCTCGGACTGCAGCACCTGCGGATGGACACCCGGGCCCCGGAC
GGGTCCGTGCACACGACGGTCTCCGGCCGGGTCTGCGAGCCGGGCCGGCGGATCGTGTAC
AAGCAGACGACACTGCCGCCCGTGCTCCAGGCGCACAACGGCGAGTGGCTCGTCGAGGAG
ACGGGCGACGGTGCCGTCCGTGTGACGGCCCGGCACCAGGTGATCCTCGACCCGGAGGGG
ATCGCCGGTCTCGCCGAGCCGCCCGAGTCGCTCGCCGCCGCGCGGGATGCTGTCCGTGAG
GCGCTCGGCGCCAACAGCAGGGCGACCATGGCGCGGGCCCGCGCCTTCGCCGAGGCGAAC
CGACCCCGTACCCCCCGCCACCACACGAAAGGGAACACCGCCATGGCCGAACTGACCCTC
GACGAGCTCAAGCGCTTCCTGCTGAGCGCGGCCGGAGACGACGAGAGCGTCGAGCTGTCC
GGCGACATCCTCCACGTCCGCCTGGTCGACCTGGGCTTCGACTCGCTCGCCGTGATCGAC
ACCCTGGGCCGGCTGGAGCGCCACTTCGGCGTCAAACTGCCCGAGGAGGCGACCACCGAG
GTGGAGACCCCGGCGGACCTCCTCGCCGCCGTCAACCGCCAGGTCGCCGAGGCCGCCTGA
ACP239..312
ACP715..936

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [270-285]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [239-312]  PS50075
PS50075   ACP_DOMAIN
 [238-317]  3.1e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [235-318]  7.99999145876753e-14 SSF47336
SSF47336   ACP_like
 [250-311]  7e-08 PF00550
PF00550   PP-binding
IPR019587 Polyketide cyclase/dehydrase (Family)
 [68-217]  4.70000000000001e-12 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [66-172]  1.1e-08 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-38]  0.04 Signal
Bacteria, Gram-negative   
TMHMM No significant hit