close all open/close all

CDS information : Heda_00270


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction38,734 / 37,469 / - [in whole cluster]
38,734 / 37,469 / - [in contig]
Locationcomplement(37469..38734) [in whole cluster]
complement(37469..38734) [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)keto synthase beta
GenehedD
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • orf6
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

CLF4..361

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [keto synthase beta]
MSDALITGIGVAAPNGVGLENYWAATLKGASAVRPATRFDTAGHPVVLAAEVPESEAEAA
FPRRLHPQTDRLTRLALLSSDEALADAGIDPAALDGYAMGTAVTGVTGGLEFGQRQLQLQ
WGTGWESVSPYMSFAWYYAVHTGQVSIRHGMRGPGGVVVSEQAGGLDSLAFARRRVRTGT
AVMTAGGFDSMLCPYGMSVLSVADGVSRDGDPARAGLPFCAASTGFVPGEGGAVLVVEPG
AGAAERGAPHRYGLIAGHGAAFDPDPAGSDGSSRSGLLRAARAALRDAGMTPDDIGVVFA
DGVGSGPLDRAEAAVLTGLFGSRRVPVSAPKALVGRMLSGGSALDVVAALLTLRDGLIPA
VPGVRREDVDPRVELVVGEPRAERVDSALVLARGHGGFASALVLTRAGGGPSFRRPRRPG
G
selected fasta
>polyketide synthase chain length factor subunit [keto synthase beta]
ATGAGCGACGCGCTGATCACGGGCATCGGAGTGGCCGCCCCCAACGGGGTGGGCCTGGAG
AACTACTGGGCGGCCACGCTCAAGGGAGCGTCCGCCGTCCGGCCGGCGACGCGCTTCGAC
ACGGCGGGGCACCCGGTCGTGCTCGCGGCCGAGGTCCCCGAGTCGGAGGCGGAGGCCGCC
TTCCCCCGGCGGCTGCACCCGCAGACCGACCGGCTGACCCGGCTGGCGCTGCTGTCGTCC
GACGAGGCGCTGGCCGATGCCGGGATCGACCCGGCCGCGCTGGACGGCTACGCGATGGGC
ACGGCCGTCACGGGCGTCACCGGCGGGCTGGAGTTCGGCCAGCGGCAGCTCCAGTTGCAG
TGGGGCACGGGCTGGGAGTCGGTGAGCCCGTACATGTCGTTCGCCTGGTACTACGCGGTG
CACACCGGACAGGTGTCGATCCGGCACGGGATGCGCGGTCCGGGCGGGGTCGTGGTGTCC
GAACAGGCCGGCGGCCTGGACTCGCTGGCGTTCGCGCGCCGCCGGGTGCGGACCGGGACG
GCGGTGATGACGGCGGGCGGCTTCGACAGCATGCTGTGCCCCTACGGCATGTCGGTGCTG
TCGGTGGCCGACGGAGTGAGCCGGGACGGCGATCCGGCCCGGGCCGGGCTGCCGTTCTGC
GCGGCCTCCACCGGCTTCGTGCCGGGAGAGGGCGGCGCCGTCCTGGTGGTGGAGCCCGGT
GCCGGGGCCGCGGAACGCGGGGCGCCGCACCGCTACGGGCTGATCGCCGGCCACGGCGCC
GCGTTCGACCCGGACCCGGCGGGGTCGGACGGCTCGTCGCGCAGCGGCCTGCTCAGGGCG
GCGCGCGCGGCGCTGCGGGACGCCGGGATGACACCGGACGACATCGGCGTGGTGTTCGCG
GACGGCGTGGGCAGCGGGCCGCTGGACCGGGCCGAGGCGGCTGTCCTGACCGGGCTCTTC
GGCTCCCGGCGGGTGCCGGTGAGCGCGCCGAAGGCGTTGGTGGGGCGGATGCTCTCCGGG
GGTTCCGCGCTGGACGTGGTGGCCGCCCTGCTGACCCTGCGCGACGGCCTGATCCCGGCC
GTGCCCGGCGTCCGGCGGGAGGACGTCGATCCGCGGGTGGAGCTGGTGGTCGGTGAGCCG
CGCGCCGAGCGGGTCGACTCCGCACTGGTGCTGGCGCGGGGGCACGGGGGCTTCGCCTCG
GCGCTGGTGCTCACTCGGGCGGGGGGCGGTCCGTCGTTCAGGCGGCCTCGGCGACCTGGC
GGTTGA
CLF4..361
CLF10..1083

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-238]  4e-45 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [252-361]  7.3e-19 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [4-250]  3.9e-41 G3DSA:3.40.47.10 [273-407]  3.2e-28 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [1-248]  1.6e-52 SSF53901 [211-407]  1.4e-37 SSF53901
SSF53901   Thiolase-like
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [6-371]  0.0075 SM00825
SM00825   Beta-ketoacyl synthase
SignalP
 [1-32]  0.14 Signal
Bacteria, Gram-positive   
TMHMM No significant hit