close all open/close all

CDS information : Heda_00280


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction39,999 / 38,731 / - [in whole cluster]
39,999 / 38,731 / - [in contig]
Locationcomplement(38731..39999) [in whole cluster]
complement(38731..39999) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)putative keto synthase alpha
GenehedC
Gene (GenBank)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • orf5
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

KS7..376

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative keto synthase alpha]
MVRDTPRRAVITGIGVTAPGGIGADAFWQRLVSGRPATRTISRFDASGHRCRVAAECDFD
PLEQGLTRQQARRTDRVVQLALAAAREALEDSGLTVDGERTGVALGSAVGGTTTMEQEYA
VQSAEGRDWLVDPSYAVPHLYDYFVPTSLAAEVALLTGALGPASVISTGCTSGIDSVGYA
AEMIREGTADVMVTGASDAPISPITLTCFDVIKATSARNDDPETACRPFDRTRTGLVLGE
GASVLVLEEYEHAKRRGARIYGEIAGYASRCNAYHMTGLKADGLEMSEAIDAALDEARLN
PVDIDYVNAHGSGTRQNDRHETAAVKRSLGEHAYRTPMSGIKAIVGHSLGAIGSIEIAAC
ALSLRHGVVVPTANLDEPDPECDLDYVPHTARERRLDAVLTVGSGFGGFQSAMVLTAPGR
PA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative keto synthase alpha]
ATGGTCCGAGACACGCCCCGCAGGGCAGTGATCACCGGCATCGGCGTGACCGCACCGGGG
GGCATCGGGGCCGACGCGTTCTGGCAGCGACTGGTCAGCGGCAGGCCCGCGACCCGGACG
ATCAGCCGGTTCGACGCGAGCGGCCATCGGTGCCGGGTCGCCGCCGAGTGCGACTTCGAC
CCGCTGGAGCAGGGTCTGACCCGCCAGCAGGCGCGGCGGACCGACCGCGTGGTGCAGCTC
GCCCTGGCCGCCGCGCGGGAGGCGCTGGAGGACAGCGGCCTGACCGTCGACGGCGAGCGC
ACCGGAGTGGCGCTGGGCAGCGCGGTCGGCGGAACGACCACCATGGAGCAGGAGTACGCC
GTGCAGTCCGCCGAGGGCCGCGACTGGCTGGTCGACCCCTCGTACGCCGTACCGCACCTG
TACGACTACTTCGTGCCCACCTCGCTGGCCGCCGAGGTGGCGCTGCTGACCGGGGCGCTG
GGCCCGGCCTCGGTGATCTCGACCGGGTGCACGTCGGGCATCGACTCCGTCGGCTACGCC
GCCGAGATGATCCGGGAGGGAACCGCCGACGTCATGGTCACCGGCGCCTCCGACGCGCCC
ATCTCACCGATCACCCTGACCTGCTTCGACGTCATCAAGGCCACCTCCGCCCGCAACGAC
GACCCGGAGACGGCCTGCCGCCCCTTCGACCGCACCCGCACCGGGCTGGTGCTGGGCGAG
GGCGCGAGCGTGCTGGTACTGGAGGAGTACGAGCACGCCAAGCGGCGCGGCGCCCGCATC
TACGGGGAGATCGCCGGCTACGCCTCCCGGTGCAACGCCTACCACATGACCGGTCTGAAG
GCGGACGGTCTGGAGATGTCCGAGGCGATCGACGCGGCGCTCGACGAGGCCCGGCTGAAC
CCGGTGGACATCGACTACGTCAACGCCCACGGCTCCGGCACCCGGCAGAACGACCGGCAC
GAGACCGCCGCGGTCAAGCGCAGCCTGGGCGAGCACGCCTACCGCACGCCGATGAGCGGC
ATCAAGGCGATCGTGGGGCACTCGCTCGGCGCGATCGGCTCGATCGAGATCGCGGCGTGC
GCGCTGTCCCTGCGGCACGGGGTGGTGGTGCCCACGGCCAATCTCGACGAGCCCGACCCC
GAGTGCGACCTGGACTACGTCCCGCACACCGCGCGGGAGCGGCGACTGGACGCGGTGCTC
ACGGTGGGCAGCGGTTTCGGCGGGTTCCAGAGCGCCATGGTGCTGACGGCTCCGGGACGG
CCCGCATGA
KS7..376
KS19..1128

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [7-252]  1.29999999999998e-55 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-376]  3.5e-34 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [6-266]  2.50000000000001e-64 G3DSA:3.40.47.10 [271-417]  3.60000000000002e-50 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [6-258]  4.50001022902825e-68 SSF53901 [220-418]  1.20000117458134e-63 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit