close all open/close all

CDS information : Heda_00290


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction40,439 / 41,404 / + [in whole cluster]
40,439 / 41,404 / + [in contig]
Location40439..41404 [in whole cluster]
40439..41404 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)cyclase
GenehedB
Gene (GenBank)
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
  • orf4
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q02057
NITE
Actino_00220
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)
ACC
Q9X466
NITE
Naphcy_00060
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [cyclase]
MDGTFRPLPDDERASEIEVTFTPEPGGGTRVELAHTRLDKLGDSDGERIFKALDGPSPGE
TLARFAEAGVMAVAHTVAGPGLLEIADGVYAREQLPGGWCLNNAGLVAGGGRAVLVDTAA
TRARARHLAAAVDAVAPGGPDVVVNTHFHGDHVFGNVEFAPRATVVAHEQTRSDVAESGH
GLCRLWPTVDWGDIPLVLPDVTFEDELTFHAGDLTVHLLHVGPAHTPGDVVAWVPERKVL
FARGRRVVPGHAVRPDGLGARLSGGPGAPARSPARGGGRRARTGVRHRGTGRHRGVPPPP
RRRRPGGAARRPHPARRRTGG
selected fasta
>putative cyclase/dehydratase [cyclase]
GTGGACGGCACCTTCCGGCCGCTGCCCGACGACGAACGGGCCAGCGAGATCGAGGTGACC
TTCACCCCGGAACCGGGCGGCGGCACCCGGGTCGAGCTGGCGCACACCCGGCTCGACAAG
CTCGGCGACAGCGACGGCGAACGCATCTTCAAGGCCCTGGACGGGCCGAGCCCCGGTGAG
ACGCTGGCCCGGTTCGCCGAGGCCGGTGTGATGGCCGTTGCGCACACCGTCGCCGGACCC
GGCCTGCTGGAGATCGCCGACGGCGTCTACGCCCGTGAACAACTGCCCGGCGGCTGGTGT
CTGAACAACGCCGGTCTGGTGGCCGGCGGCGGTCGTGCGGTCCTCGTCGACACCGCGGCC
ACCCGGGCCCGGGCCCGTCATCTCGCCGCAGCGGTGGACGCGGTGGCGCCCGGCGGTCCG
GACGTCGTGGTCAACACCCACTTCCACGGCGACCACGTCTTCGGCAACGTCGAGTTCGCC
CCCCGGGCCACCGTCGTCGCCCACGAGCAGACCCGGTCCGACGTGGCGGAGTCCGGACAC
GGGCTCTGCCGGTTGTGGCCGACGGTGGACTGGGGCGACATCCCCCTGGTACTGCCCGAC
GTGACCTTCGAGGACGAACTCACCTTCCACGCCGGAGACCTGACGGTCCATCTGCTGCAC
GTCGGACCCGCGCACACCCCCGGCGACGTGGTGGCCTGGGTGCCGGAGCGCAAGGTGCTC
TTCGCCCGGGGACGTCGTGTGGTCCCGGGTCACGCCGTTCGTCCTGATGGGCTCGGTGCA
CGGCTCTCTGGAGGCCCTGGAGCGCCTGCGCGGTCTCCGGCCCGAGGTGGTGGTCGCCGG
GCACGGACCGGTGTCCGGCACCGAGGCACTGGACGCCACCGAGGCGTACCTCCGCCTCCT
CGGCGACGTCGCCCGGGAGGGGCTGCGCGCCGGCCGCACCCCGCTCGCCGCCGCACGGGC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [98-242]  5.20000000000001e-17 PF00753
PF00753   Lactamase_B
 [101-287]  9.00000407957274e-20 SM00849
SM00849   Lactamase_B
SignalP No significant hit
TMHMM No significant hit