close all open/close all

CDS information : Heda_00300


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction41,609 / 42,388 / + [in whole cluster]
41,609 / 42,388 / + [in contig]
Location41609..42388 [in whole cluster]
41609..42388 [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)keto reductase
GenehedA
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf3
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)
[21776967] Structural and biochemical studies of the hedamycin type II polyketide ketoreductase (HedKR): molecular basis of stereo- and regiospecificities. (Biochemistry. , 2011)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase [keto reductase]
MSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSC
DVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVT
REVLRAGGMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITV
NAVCPGYVETPMAERVREGYARHWGVTEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTD
AAASITAQALNVCGGLGNY
selected fasta
>polyketide C-9 ketoreductase [keto reductase]
ATGTCCCGTCCCCAGACCGCCTTCGTCACCGGGGTCAGCAGCGGAATCGGCCTGGCGGTC
GCCCGCACCCTCGCCGCCCGGGGGATCGCCGTCTACGGATGCGCCCGGGACGCCAAGAAC
GTCTCGGCCGCGGTCGACGGCCTGCGCGCCGCCGGTCACGACGTCGACGGGTCCTCCTGC
GACGTCACGTCGACCGACGAGGTGCATGCCGCCGTCGCGGCCGCCGTTGAGCGCTTCGGC
CCCATCGGCATTCTGGTCAACAGCGCCGGCCGCAACGGCGGCGGGGAGACCGCCGACCTC
GACGACGCCCTCTGGGCGGACGTCCTCGACACCAACCTGACCGGTGTCTTCCGGGTCACC
CGGGAGGTGCTGCGGGCCGGGGGCATGCGCGAGGCGGGCTGGGGCAGGATCGTCAACATC
GCCTCCACCGGGGGCAAGCAGGGAGTGATGTACGCCGCCCCCTACACGGCCTCGAAGCAC
GGTGTCGTCGGCTTCACCAAGTCCGTCGGCTTCGAACTGGCCAAGACGGGCATCACCGTC
AACGCCGTCTGCCCCGGTTACGTGGAGACGCCGATGGCGGAGCGGGTCCGCGAGGGCTAC
GCACGGCACTGGGGCGTGACCGAGCAGGAGGTCCATGAGCGCTTCAACGCCAAGATCCCG
TTGGGCCGTTACTCCACCCCTGAGGAGGTGGCGGGCCTCGTGGGCTACCTGGTCACGGAC
GCCGCCGCCTCCATCACGGCGCAGGCCCTGAACGTCTGCGGCGGCCTGGGCAACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [80-91]  9.40001006865064e-12 PR00080 [135-143]  9.40001006865064e-12 PR00080 [155-174]  9.40001006865064e-12 PR00080
PR00080   SDRFAMILY
 [6-172]  2.1e-32 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [6-23]  5.09998762524166e-44 PR00081 [80-91]  5.09998762524166e-44 PR00081 [129-145]  5.09998762524166e-44 PR00081 [155-174]  5.09998762524166e-44 PR00081 [176-193]  5.09998762524166e-44 PR00081 [220-240]  5.09998762524166e-44 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-256]  3.99999999999998e-79 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-26]  0.975 Signal
Bacteria, Gram-positive   
 [1-21]  0.935 Signal
Bacteria, Gram-negative   
 [1-25]  0.933 Signal
Eukaryota   
TMHMM No significant hit