close all open/close all

CDS information : Heda_00310


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction44,094 / 43,426 / - [in whole cluster]
44,094 / 43,426 / - [in contig]
Locationcomplement(43426..44094) [in whole cluster]
complement(43426..44094) [in contig]
TypeCDS
Length669 bp (222 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative TetR-family regulatory protein
GeneorfH2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf2
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9AJL5
NITE
Virg_00370
PmId
[11222601] Identification of the varR gene as a transcriptional regulator of virginiamycin S resistance in Streptomyces virginiae. (J Bacteriol. , 2001)
Family/Domain
FD
IPR001647, IPR004111

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative TetR-family regulatory protein]
MPQPSAPRKTLGRPPRISREEIIETARRIVTEKGVDRLTMRRLATEVGSTPMALYHHVRD
KEELLLLLLDDYAARTLRRPELPAEPRERIVVAATAIHEALAACPWIVEVLTADDLLSTS
ALWFVEQIVDGLVECGLCLDRAVHGYRAIWYYTAGEIVVRTTAARRRADDDRATYREQVF
ADLDPRELPRLAQAADRWAPLTAEDIYQDGLRALVDGLLTGH
selected fasta
>putative TetR family transcriptional regulator [putative TetR-family regulatory protein]
ATGCCGCAACCGTCCGCACCGCGCAAAACCCTGGGCCGACCTCCCCGTATCTCCCGCGAG
GAGATCATCGAGACGGCCCGCCGGATCGTGACCGAGAAAGGCGTGGACCGGCTGACCATG
CGGCGGCTGGCCACGGAGGTCGGCAGCACGCCGATGGCGCTCTACCACCACGTCCGCGAC
AAGGAAGAACTGCTCCTCCTCCTGCTGGACGACTACGCCGCACGGACACTGCGCCGGCCC
GAACTGCCGGCCGAGCCTCGTGAACGGATCGTCGTCGCCGCCACCGCGATCCACGAGGCG
CTGGCCGCCTGTCCGTGGATCGTGGAGGTACTGACCGCCGACGACCTGTTGTCCACCTCC
GCGCTGTGGTTCGTCGAGCAGATCGTGGACGGGCTGGTCGAATGCGGCCTCTGCCTCGAC
CGGGCCGTACACGGCTACCGTGCGATCTGGTACTACACCGCCGGAGAGATCGTGGTCAGG
ACGACAGCCGCCCGGCGGCGCGCGGACGACGACCGCGCGACCTATCGGGAGCAGGTCTTC
GCCGATCTCGACCCGAGGGAGCTGCCCCGTCTGGCGCAGGCCGCGGACCGCTGGGCGCCG
CTGACCGCCGAGGACATCTACCAGGACGGGCTCCGCGCCCTGGTGGACGGCCTTCTCACC
GGCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [22-66]  9.40000000000003e-13 PF00440
PF00440   TetR_N
 [22-35]  2.50000086445942e-06 PR00455 [43-66]  2.50000086445942e-06 PR00455
PR00455   HTHTETR
 [16-76]  PS50977
PS50977   HTH_TETR_2
IPR004111 Tetracycline transcriptional regulator, TetR, C-terminal (Domain)
 [80-220]  8.20000000000001e-13 PF02909
PF02909   TetR_C
IPR009057 Homeodomain-like (Domain)
 [8-74]  1.5e-21 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [15-86]  6.80000200614766e-15 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [84-218]  8.30001403791589e-18 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [75-218]  8.1e-23 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit