close all open/close all
Heda_00310 Heda_00310   last last

CDS information : Heda_00320


close this sectionLocation

Organism
StrainATCC 15422
Entry nameHedamycin
Contig
Start / Stop / Direction44,086 / 45,603 / + [in whole cluster]
44,086 / 45,603 / + [in contig]
Location44086..45603 [in whole cluster]
44086..45603 [in contig]
TypeCDS
Length1,518 bp (505 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)membrane transport protein
GeneorfH1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf1
Reference
ACC
PmId
[15271354] The hedamycin locus implicates a novel aromatic PKS priming mechanism. (Chem Biol. , 2004)
Related Reference
ACC
Q9WVV3
PmId
[10198016] Mitomycin resistance in Streptomyces lavendulae includes a novel drug-binding-protein-dependent export system. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative drug resistance transporter [membrane transport protein]
MRHAPIIPRVSTAAARGATFLTCIETLGRSRAWCWRRPPSPNSSSPWTCPWSTSPCPRSV
LPWDSHHSTCRGSVHVYALTFGGFLLLGGRACDLYGRRRMFVLGLIVFGLCSLAGGLAQT
PWHLIAARAGQGLGAAAAAPAALAMLTTTFAEGPRRVRALGVWSAVNAAGGALGVLAGGL
LTEYAGWRWVMLVNLPIVAAALALIAAGVPATAASAPRERLDALGAALATGGVGLLVLGV
VRTDTLGWDSPLTWATLAAAAVLLAAFLFAESRADAPLLRLGLLRSRWVAGANVLVFLAA
AGQFTAFYFVSLYMQQVLGMGAAATGIAFLPFSLGLVAGTVVATRITAARTPRASLVPGA
LLAAAGLAWFALISPDGGFLTDVLGPSLVTSVGAGLVLAPVAAAATTGVAAREAGMASGL
MNSSRQLGGSIGLAVLATLAAHHTGTATDPAALNDGYGLGLAVAAAVFVLAAVVAIGVLP
RRRRPVAPVPRSTASEENELEGTPS
selected fasta
>putative drug resistance transporter [membrane transport protein]
TTGCGGCATGCCCCCATCATCCCTCGGGTGTCGACAGCGGCGGCCCGCGGCGCTACTTTT
CTTACATGTATAGAAACTCTCGGGAGAAGTCGAGCGTGGTGCTGGCGGCGGCCGCCGTCG
CCCAATTCGTCGTCGCCCTGGACCTGTCCGTGGTCAACGTCGCCCTGCCCGCGATCCGTA
CTGCCCTGGGATTCGCACCACTCGACCTGTCGTGGGTCCGTGCACGTGTACGCCCTTACG
TTCGGCGGGTTCCTGCTGCTGGGAGGCCGCGCCTGCGACCTGTACGGCCGGCGTCGGATG
TTCGTGCTGGGACTGATCGTCTTCGGCCTGTGCTCGCTGGCCGGCGGGCTGGCCCAGACG
CCCTGGCATCTGATCGCCGCACGCGCCGGGCAGGGCCTGGGCGCCGCCGCGGCCGCACCG
GCCGCACTGGCGATGCTCACCACCACCTTCGCCGAAGGGCCCCGGCGCGTCCGCGCGCTC
GGAGTGTGGAGCGCGGTGAACGCCGCGGGCGGCGCGCTGGGCGTGCTGGCGGGCGGGCTG
CTGACCGAGTACGCGGGCTGGCGCTGGGTTATGCTGGTCAACCTGCCCATCGTCGCCGCG
GCCCTCGCCCTCATTGCCGCAGGGGTGCCCGCCACAGCAGCGTCCGCCCCGCGCGAAAGG
CTGGACGCGCTGGGCGCCGCTCTGGCGACCGGCGGAGTCGGGCTGCTGGTGCTCGGTGTC
GTCCGCACCGACACCCTTGGCTGGGACTCCCCGCTCACGTGGGCGACCCTCGCTGCCGCT
GCCGTACTGCTGGCCGCCTTCCTCTTCGCCGAGTCGAGGGCCGACGCACCGCTGCTGCGC
CTCGGCCTGCTGCGCAGCCGCTGGGTCGCCGGCGCGAACGTGCTGGTGTTCCTCGCCGCG
GCCGGGCAGTTCACGGCGTTCTACTTCGTCTCCCTGTACATGCAGCAGGTCCTGGGCATG
GGAGCCGCAGCGACCGGCATCGCGTTCCTGCCCTTCTCCCTGGGCCTGGTCGCGGGGACC
GTCGTCGCGACCCGCATCACCGCGGCACGCACCCCCCGCGCCTCCCTGGTGCCCGGCGCC
CTGCTGGCCGCCGCGGGCCTGGCCTGGTTCGCCCTCATCAGTCCCGACGGCGGTTTCCTC
ACCGACGTGCTCGGCCCCTCCCTCGTCACCAGCGTCGGCGCCGGACTGGTCCTGGCCCCG
GTCGCCGCCGCCGCGACCACCGGAGTCGCCGCGCGGGAGGCCGGAATGGCCTCCGGCCTC
ATGAACAGCTCACGCCAACTCGGCGGCTCCATCGGGCTGGCCGTCCTGGCCACCCTTGCC
GCGCACCACACCGGCACAGCAACCGACCCCGCCGCGCTCAACGACGGCTACGGCCTGGGG
CTGGCCGTCGCCGCCGCCGTCTTCGTGCTCGCGGCGGTCGTGGCGATCGGTGTGCTGCCG
CGCCGCCGCCGGCCCGTCGCACCCGTCCCGCGATCCACCGCTTCTGAAGAGAACGAGCTG
GAAGGAACACCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [76-432]  2.1e-38 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [76-484]  9.7e-55 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [1-483]  29.413 PS50850
PS50850   MFS
SignalP
 [1-17]  0.583 Signal
Bacteria, Gram-negative   
 [1-32]  0.752 Signal
Eukaryota   
 [1-32]  0.552 Signal
Bacteria, Gram-positive   
TMHMM
 [100-119]  Transmembrane (i-o) [124-146]  Transmembrane (o-i) [159-181]  Transmembrane (i-o) [186-208]  Transmembrane (o-i) [221-243]  Transmembrane (i-o) [253-270]  Transmembrane (o-i) [291-310]  Transmembrane (i-o) [320-342]  Transmembrane (o-i) [354-373]  Transmembrane (i-o) [388-410]  Transmembrane (o-i) [423-442]  Transmembrane (i-o) [457-479]  Transmembrane (o-i)
Transmembrane 12   
Heda_00310 Heda_00310   last last