close all open/close all
first first   Herb_00020 Herb_00020

CDS information : Herb_00010


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction2,359 / 71 / - [in whole cluster]
2,359 / 71 / - [in contig]
Locationcomplement(71..2359) [in whole cluster]
complement(71..2359) [in contig]
TypeCDS
Length2,289 bp (762 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative cation-transporting ATPase
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1p; ORF1; similar to Streptomyces coelicolor SC00860c and Streptomyces avermitilis SAV617 probable cation-transporting ATPase
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O32220
PmId
[12644235] CopZ from Bacillus subtilis interacts in vivo with a copper exporting CPx-type ATPase CopA. (FEMS Microbiol Lett. , 2003)
Family/Domain
FD
IPR006416

close this sectionSequence

selected fasta
>putative cation-transporting ATPase [unknown]
MADEPTALAAMTDLSIGGMTCAACVKRVEKKLARLDGVTATVNLATGRARVNHPPEVGPD
QLIATVEQAGYTAALPEPPRKERSEDRDAAQDARRERDRLVVTALLAVPVLVVSMVPGLQ
FRNWQWLCFVLAAPVVVWGAWPFHLRAARGLRHSAATMDTLVSLGVVASFAWSSYALFFG
GAGEPGMRMPFSLVPTASDGVAHVYLEAAVGVPLFVLAGRFLETRARLGTGAALRALARL
AGKEVSVRDGDGERLVPIEELRVGQVFVARPGERLATDGTVVEGSSAVDLSLVTGESEPV
EVGPGTPVTGGAVNAGGLLLVRATAVGADTQLSRITRLVTEAQAGKARAQRLADKAAGVF
VPVVLTLAVTVLGFWLGAGAEPQAAITASVAVLVVACPCALGLATPTALMAATGRGAQLG
VLVSGPQALEGLRHLDAVVLDKTGTLTSGQMSVARVTAVPGGLGEEELVRLAGAVEQGSE
HPLGRAITAHARRTVPGKSLPAVADFVALPGKGVRGRVADRLVEVLAPDDALPPVLAQAL
SASETAARTPVVVRVDGETEALIEVGDVLRPGSYRAVERLRRLGVRPVLATGDREAPARA
VATDLRIEEVHARCTPEDKAALVRELREQGYRVAVVGDGVNDAAALAGADLGIAMGTGTD
VAIGAADVTLVRGDIETLADAVRLARSALATIRVNLLWAFGYNAVTVPLAMVGLLNPMLA
AAAMSVSSLLVVGNSLRLRAWQPSPAGHRPSRPAAPAARKPL
selected fasta
>putative cation-transporting ATPase [unknown]
ATGGCCGACGAACCGACGGCCTTGGCCGCCATGACCGACCTCTCCATCGGCGGCATGACC
TGCGCGGCCTGTGTGAAGCGTGTCGAGAAGAAGCTGGCCAGGCTGGACGGGGTCACGGCC
ACCGTGAACCTCGCCACCGGCCGGGCCCGGGTGAACCACCCGCCCGAGGTCGGCCCGGAC
CAGCTCATCGCCACCGTCGAGCAGGCCGGCTACACCGCCGCGCTGCCCGAGCCGCCCAGG
AAGGAACGGAGCGAGGACAGGGACGCGGCGCAGGACGCCCGGCGGGAGCGCGACCGGCTG
GTGGTCACGGCGTTGCTCGCGGTCCCGGTGCTGGTCGTGTCGATGGTTCCCGGTCTCCAG
TTCCGCAACTGGCAGTGGCTGTGCTTCGTGCTCGCCGCCCCCGTCGTCGTCTGGGGAGCC
TGGCCCTTCCACCTGCGGGCGGCGCGCGGCCTGCGCCACTCGGCGGCGACCATGGACACT
CTGGTGTCGCTGGGTGTCGTGGCCTCCTTCGCCTGGTCCTCCTACGCGCTGTTCTTCGGC
GGGGCCGGCGAACCCGGGATGCGGATGCCCTTCAGCCTGGTGCCCACCGCCTCGGACGGC
GTGGCCCATGTCTATCTGGAAGCCGCCGTCGGCGTACCGCTGTTCGTCCTCGCCGGCCGC
TTCCTGGAAACGCGGGCCCGGCTGGGGACCGGCGCGGCACTGCGCGCCCTGGCCCGGCTG
GCCGGCAAGGAGGTATCGGTACGCGACGGCGACGGCGAGCGCCTGGTCCCGATCGAGGAA
CTGCGGGTCGGCCAGGTCTTCGTCGCCCGGCCCGGCGAGCGCCTGGCCACCGATGGCACG
GTGGTGGAGGGCAGCTCGGCCGTCGATCTGTCCCTGGTCACCGGGGAGAGCGAGCCGGTG
GAAGTCGGCCCCGGCACGCCCGTGACCGGCGGTGCCGTCAACGCGGGGGGCCTGCTCCTG
GTACGGGCCACCGCGGTCGGCGCCGATACCCAACTGTCCCGGATCACCCGGCTGGTGACC
GAGGCCCAGGCGGGCAAGGCACGGGCGCAGCGGCTCGCCGACAAGGCCGCGGGCGTCTTC
GTCCCGGTCGTGCTCACCCTGGCCGTCACCGTCCTCGGATTCTGGCTCGGGGCCGGTGCC
GAGCCACAGGCCGCGATCACCGCGAGCGTGGCCGTCCTGGTCGTGGCGTGCCCCTGCGCG
CTGGGCCTGGCGACCCCCACCGCGCTGATGGCGGCGACCGGCCGGGGCGCCCAACTGGGC
GTCCTGGTCAGCGGACCGCAGGCGCTGGAGGGGCTGCGGCACCTGGACGCCGTCGTACTG
GACAAGACCGGCACCCTCACTTCCGGGCAGATGAGTGTCGCCCGGGTCACCGCCGTACCG
GGCGGGCTCGGCGAGGAGGAACTGGTCCGGCTGGCGGGCGCGGTCGAACAGGGATCGGAA
CACCCGCTGGGGCGTGCCATCACCGCCCATGCCCGGCGCACCGTTCCCGGAAAGTCCCTC
CCGGCCGTGGCCGACTTCGTCGCGCTGCCGGGCAAGGGCGTGCGCGGGCGGGTGGCGGAC
CGGCTGGTCGAAGTCCTGGCCCCGGACGACGCGTTGCCCCCGGTATTGGCTCAGGCGCTG
TCGGCCTCCGAGACCGCCGCCCGTACACCGGTCGTGGTCCGCGTCGACGGCGAGACCGAG
GCACTGATCGAGGTCGGTGATGTGCTGCGCCCGGGAAGCTACCGGGCCGTGGAGCGGCTC
CGCCGCCTGGGCGTGCGACCGGTGCTCGCCACCGGCGACCGCGAGGCGCCCGCCCGCGCC
GTCGCCACCGACCTCCGCATCGAGGAGGTGCACGCCCGGTGCACCCCGGAGGACAAGGCC
GCCCTCGTCCGGGAGCTGCGGGAGCAGGGCTACCGGGTCGCCGTCGTCGGTGACGGGGTC
AACGACGCGGCCGCCCTGGCCGGCGCCGACCTCGGCATCGCCATGGGCACGGGCACGGAT
GTGGCGATCGGGGCGGCCGATGTGACCCTGGTACGCGGTGACATCGAGACCCTGGCGGAC
GCGGTCCGCCTCGCCCGCAGTGCGCTCGCCACGATCCGCGTCAATCTGCTCTGGGCGTTC
GGCTACAACGCCGTGACCGTACCGCTGGCCATGGTCGGCCTGCTCAACCCCATGCTCGCG
GCGGCCGCGATGTCGGTCAGCTCGCTGCTGGTGGTCGGCAACAGCCTGCGGCTACGCGCC
TGGCAGCCGTCGCCGGCCGGCCACCGCCCTTCCCGGCCCGCCGCACCTGCCGCGCGGAAG
CCACTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001757 ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter (Family)
 [215-458]  1.80000000000002e-35 TIGR01494 [547-723]  1.40000000000001e-38 TIGR01494
TIGR01494   ATPase_P-type
 [289-303]  4.60000044330862e-23 PR00119 [439-453]  4.60000044330862e-23 PR00119 [583-593]  4.60000044330862e-23 PR00119 [636-655]  4.60000044330862e-23 PR00119 [659-671]  4.60000044330862e-23 PR00119
PR00119   CATATPASE
IPR005834 Haloacid dehalogenase-like hydrolase (Domain)
 [436-650]  1.80000000000002e-40 PF00702
PF00702   Hydrolase
IPR006121 Heavy metal-associated domain, HMA (Domain)
 [11-75]  PS50846
PS50846   HMA_2
 [15-72]  6e-13 PF00403
PF00403   HMA
 [8-80]  3.0999994589937e-19 SSF55008
SSF55008   HeavyMe_transpt
IPR006403 ATPase, P type, cation/copper-transporter (Family)
 [198-739]  TIGR01511
TIGR01511   ATPase-IB1_Cu
 [53-73]  2.10000037262656e-07 PR00943 [143-162]  2.10000037262656e-07 PR00943 [362-376]  2.10000037262656e-07 PR00943 [613-630]  2.10000037262656e-07 PR00943 [670-684]  2.10000037262656e-07 PR00943
PR00943   CUATPASE
IPR006404 ATPase, P-type, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating (Family)
 [203-738]  2.70000000000002e-107 TIGR01512
TIGR01512   ATPase-IB2_Cd
IPR006416 ATPase, P-type, heavy metal translocating (Family)
 [158-738]  TIGR01525
TIGR01525   ATPase-IB_hvy
IPR008250 ATPase, P-type, ATPase-associated domain (Domain)
 [214-430]  1.29999999999998e-44 PF00122
PF00122   E1-E2_ATPase
IPR017969 Heavy-metal-associated, conserved site (Conserved_site)
 [16-44]  PS01047
PS01047   HMA_1
IPR018303 ATPase, P-type phosphorylation site (PTM)
 [441-447]  PS00154
PS00154   ATPASE_E1_E2
IPR023214 HAD-like domain (Domain)
 [435-686]  9.19998414420354e-44 SSF56784
SSF56784   HAD-like_dom
 [429-455]  4.39999999999997e-45 G3DSA:3.40.50.1000 [567-705]  4.39999999999997e-45 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
IPR023299 ATPase, P-type, cytoplasmic domain N (Domain)
 [456-566]  5.09999999999998e-17 G3DSA:3.40.1110.10
G3DSA:3.40.1110.10   ATPase_P-typ_cyto_domN
IPR023300 ATPase, P-type, cytoplasmic transduction domain A (Domain)
 [156-339]  8.1e-20 G3DSA:2.70.150.10
G3DSA:2.70.150.10   ATPase_P-typ_cyto_domA
SignalP No significant hit
TMHMM
 [99-121]  Transmembrane (i-o) [126-148]  Transmembrane (o-i) [161-183]  Transmembrane (i-o) [203-222]  Transmembrane (o-i) [356-378]  Transmembrane (i-o) [383-405]  Transmembrane (o-i) [694-716]  Transmembrane (i-o)
Transmembrane 7   
first first   Herb_00020 Herb_00020