close all open/close all

CDS information : Herb_00020


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction2,775 / 2,359 / - [in whole cluster]
2,775 / 2,359 / - [in contig]
Locationcomplement(2359..2775) [in whole cluster]
complement(2359..2775) [in contig]
TypeCDS
Length417 bp (138 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF2p; ORF2; similar to Streptomyces coelicolor SC00861c and Streptomyces avermitilis SAV618 putative secreted protein
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MNRAEQVTRSPDEPGVMTRITARRRNSAAGRPDSSTGTAGSAEAVRSDWKFPHMAQPRPS
ARRTPGAFLSRALPPPALCGFLLLLVMVFAASYAVGAGAGPVAPGMHGSSTTDGGSGDGH
GGGGMDMGGMDTDQGSGR
selected fasta
>hypothetical protein [unknown]
ATGAACAGGGCTGAGCAGGTCACGCGCTCGCCGGACGAGCCCGGTGTCATGACGCGCATC
ACAGCACGGCGCCGGAACTCGGCTGCCGGTCGTCCCGACTCCTCTACCGGTACGGCCGGA
TCCGCTGAAGCCGTACGGAGTGATTGGAAGTTTCCTCATATGGCGCAGCCCCGCCCATCT
GCCCGCCGGACACCGGGTGCGTTCCTGTCCAGGGCATTGCCCCCGCCGGCGCTGTGCGGA
TTCCTGCTGCTGCTGGTGATGGTGTTCGCCGCCTCCTACGCCGTCGGCGCGGGCGCCGGG
CCCGTCGCCCCCGGCATGCACGGCAGCAGCACGACAGACGGCGGCTCGGGAGACGGCCAC
GGCGGTGGCGGCATGGACATGGGCGGCATGGACACGGACCAGGGGAGTGGACGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [81-103]  Transmembrane (i-o)
Transmembrane 1