close all open/close all

CDS information : Herb_00030


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction3,745 / 2,762 / - [in whole cluster]
3,745 / 2,762 / - [in contig]
Locationcomplement(2762..3745) [in whole cluster]
complement(2762..3745) [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3p; ORF3; similar to Pseudomonas aeruginosa PA2234 PvcA and Vibrio cholerae VC1949
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MPPCPRRAYPHGGTHLMPLTTAPDTRSTSGMSAAILDLLLPYHRTTDPTPTAAESFAHQL
RQIGGFVRAGEPVVLTLPGFPCKSPNPAKVLGHLPDQGERLSLGFLNTLCEEIERVHPPG
ARVIICSDGHVFGDLIRVPDDHIDAYANELRRLIRELALHRLSVFDLRDILGDLPHHTKR
AQVHERYAPTLEALRAEVRSEDHTLALYRGITRFLVDDTADFTGTRSALQRACRTRAYGV
IQRSRAWGDLIAEHHPGSVRLSIHPQPIGAAKFGIRLLDAADVWTTPWHSAALHRTDGTW
TLMPRARAERLGRLVHRDGRPSHYEQG
selected fasta
>hypothetical protein [unknown]
ATGCCCCCATGCCCGCGTCGCGCATACCCTCACGGAGGAACCCACCTCATGCCGCTGACG
ACCGCACCGGACACCCGCTCCACGAGCGGCATGAGCGCCGCCATCCTGGACCTGCTGCTG
CCGTACCACCGCACGACCGACCCCACGCCCACGGCGGCGGAGTCGTTCGCGCACCAGTTG
CGCCAGATCGGCGGGTTCGTCCGCGCCGGAGAACCCGTGGTCCTCACCCTGCCCGGCTTC
CCCTGCAAGTCGCCCAACCCCGCCAAGGTTCTCGGCCACCTCCCCGACCAGGGCGAACGC
CTCTCCCTCGGCTTTCTGAACACCCTGTGCGAGGAGATCGAGCGGGTCCACCCGCCGGGC
GCCCGCGTGATCATCTGCTCCGACGGCCATGTCTTCGGCGACCTGATCCGCGTCCCGGAT
GACCACATAGACGCCTACGCAAACGAACTCAGACGCCTCATACGGGAGTTGGCACTGCAC
CGCCTCTCCGTCTTCGACCTGCGCGACATCCTGGGCGACCTGCCCCACCACACCAAGCGC
GCCCAGGTGCACGAGCGGTACGCCCCCACCCTGGAGGCGCTGCGAGCCGAGGTCCGCTCC
GAGGACCACACCCTCGCCCTGTACCGGGGCATCACCCGGTTCCTCGTCGACGACACCGCC
GACTTCACCGGCACCCGCTCCGCCCTCCAACGCGCATGCCGCACCCGTGCCTACGGCGTC
ATCCAGCGCAGCCGGGCCTGGGGCGACCTGATCGCCGAACACCACCCCGGCTCCGTACGG
CTGTCCATCCACCCCCAGCCCATCGGCGCCGCCAAATTCGGCATCCGCCTCCTGGACGCC
GCCGATGTCTGGACCACCCCCTGGCATTCGGCCGCCCTGCACCGCACCGACGGCACCTGG
ACGCTCATGCCCCGCGCCCGCGCGGAGCGGCTCGGCCGTCTCGTCCACCGTGACGGCAGA
CCGAGCCACTATGAACAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007817 Pyoverdine biosynthesis (Domain)
 [63-318]  2.09999999999996e-86 PF05141
PF05141   DIT1_PvcA
IPR017133 Pyoverdine chromophore biosynthesis protein PvcA (Family)
 [1-326]  6.4999795054176e-108 PIRSF037196
PIRSF037196   Pyoverdine_chromoph_PvcA
SignalP No significant hit
TMHMM No significant hit