close all open/close all

CDS information : Herb_00040


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction5,013 / 3,757 / - [in whole cluster]
5,013 / 3,757 / - [in contig]
Locationcomplement(3757..5013) [in whole cluster]
complement(3757..5013) [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative cytochrome P450
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4p; ORF4; P450; similar to ORF4_gdm (PikC subfamily)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O87605
NITE
Pikro_00170
PmId
[9778370] Characterization of the macrolide P-450 hydroxylase from Streptomyces venezuelae which converts narbomycin to picromycin. (Biochemistry. , 1998)
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[9831532] Hydroxylation of macrolactones YC-17 and narbomycin is mediated by the pikC-encoded cytochrome P450 in Streptomyces venezuelae. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative cytochrome P450 [unknown]
MTLQESGTAPEALPEPVPLMGCPYKSNPYPLYERMRETGPVHRVRFPSGVLAWLVTGYDA
AHSALGDERLGKNHDRGNDRWRARASIMPEPQHSQLQVHLLHQDPPTHTRMRRFVTDAFT
PRRIEQLRPRFQKLADTLVDALPETGPADLVTGFAARFPFQVLAEVIGLPDELAARFDRD
WGKVVQPVGPADPGRPLYEARLHGLQSYIAEVVAHKREHWADDLLSRLVVAHDRRELSQE
ELDSMIFQLLVAGQEPVTNQITTALIALFRHPAELARLRDNPELMPRAVDELLRYDSAFE
LTTWRFFDQDSDLHGTEVPAGDSVIISLCAANRDPRRFPDPDTLDLDRSPNPHLAFGHGI
HFCPGAALARAELQIALGTLLTRLLGAHLAIDDGDIEWIPAVLGRGTNHLPVGYDRRV
selected fasta
>putative cytochrome P450 [unknown]
ATGACCCTCCAGGAATCCGGGACGGCCCCCGAGGCCCTGCCCGAGCCCGTGCCGCTGATG
GGCTGCCCCTACAAGAGCAACCCGTACCCCCTCTACGAGCGGATGCGCGAGACCGGCCCG
GTGCACCGCGTCCGCTTTCCCAGCGGCGTACTCGCCTGGCTCGTCACCGGCTACGACGCC
GCGCACTCCGCACTGGGCGACGAGCGCCTCGGCAAGAACCACGACCGGGGCAACGACCGC
TGGCGCGCCCGCGCCTCGATCATGCCCGAGCCCCAGCACTCCCAGCTCCAGGTGCACCTC
CTCCACCAGGACCCACCGACCCACACCCGCATGCGGCGCTTCGTCACCGACGCCTTCACC
CCGCGCCGCATCGAGCAACTGAGGCCCCGCTTCCAGAAGCTGGCCGACACCCTCGTGGAC
GCCCTCCCGGAAACCGGCCCCGCGGACCTGGTCACCGGCTTCGCCGCCCGCTTCCCCTTC
CAGGTCCTCGCCGAAGTCATCGGCCTGCCAGATGAGTTGGCGGCCCGCTTCGACCGCGAC
TGGGGCAAGGTCGTCCAGCCGGTCGGACCGGCCGACCCCGGACGCCCGCTGTACGAGGCC
CGTCTGCACGGACTCCAGAGCTACATAGCCGAGGTCGTCGCCCATAAGCGCGAACACTGG
GCGGACGACCTGCTCAGCCGCCTGGTCGTGGCCCATGACCGCCGCGAACTCTCCCAGGAG
GAGCTGGACTCGATGATCTTCCAGCTCCTCGTGGCGGGCCAGGAACCGGTCACCAACCAG
ATCACCACCGCCCTGATCGCCCTCTTCCGCCACCCCGCCGAACTCGCCCGGCTGCGCGAC
AACCCGGAGCTGATGCCCCGCGCGGTCGACGAACTCCTCCGCTACGACAGCGCCTTCGAG
CTGACCACCTGGCGCTTCTTCGACCAGGACAGCGACCTGCACGGCACCGAGGTCCCGGCC
GGCGACTCGGTGATCATCTCCCTGTGCGCCGCCAACCGCGACCCGCGCCGCTTCCCCGAC
CCCGACACCCTCGACCTCGACCGCTCGCCCAACCCCCACCTCGCCTTCGGCCACGGCATC
CACTTCTGCCCCGGCGCGGCCCTGGCCCGCGCCGAACTCCAGATCGCGCTGGGCACCCTC
CTGACCCGCCTCCTCGGAGCGCATCTGGCCATCGACGACGGAGACATCGAGTGGATCCCG
GCCGTCCTCGGCCGGGGGACCAACCACCTGCCCGTCGGCTACGACCGACGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [219-383]  2.3e-21 PF00067
PF00067   p450
 [15-417]  6.7999999999999e-104 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [7-417]  7.19996395544006e-89 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [103-114]  2.90000354677981e-44 PR00359 [149-165]  2.90000354677981e-44 PR00359 [207-229]  2.90000354677981e-44 PR00359 [287-298]  2.90000354677981e-44 PR00359 [305-332]  2.90000354677981e-44 PR00359 [333-348]  2.90000354677981e-44 PR00359 [354-363]  2.90000354677981e-44 PR00359 [363-374]  2.90000354677981e-44 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [356-365]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit