close all open/close all

CDS information : Herb_00050


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction6,852 / 5,026 / - [in whole cluster]
6,852 / 5,026 / - [in contig]
Locationcomplement(5026..6852) [in whole cluster]
complement(5026..6852) [in contig]
TypeCDS
Length1,827 bp (608 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative amide synthetase
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5p; ORF5; similar to Streptomyces aureofaciens TcsG (asparagine synthase)
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q3S8R1
NITE
Oxtet_00050
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[21622525] Genetic characterization of enzymes involved in the priming steps of oxytetracycline biosynthesis in Streptomyces rimosus. (Microbiology. , 2011)
ACC
Q2MGB4
NITE
Fred_00250
PmId
[20926388] Characterization of FdmV as an amide synthetase for fredericamycin A biosynthesis in Streptomyces griseus ATCC 43944. (J Biol Chem. , 2010)
ACC
O05272
PmId
[10498721] Three asparagine synthetase genes of Bacillus subtilis. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative amide synthetase [unknown]
MCGITGWVSFHQDPRTQAPVIEAMTATLAPRGPDAAGVWLGPRAAIGHRRLAVIDLAGGV
QPMTDRPDAPTTVLTYSGEIYNHHELRSQLSGLGHEFRTRSDTEVVLRGYAEWGEKVADH
LDGMFAFAVWDERAQRLLLVRDRLGVKPLFWAEVDGGLAFASEPKALFAHPEIRPRVDAD
GLREAYSLLFNTGPTVWSGVREVEPGGLLLLDRDGIRERRYWQLEADAHPDDRDATIARV
HDLVSTAARAQLEADVPLCSLLSGGIDSTVLTALLADELRLREGPGARIRSYAVDYSDQA
ESFTGDVLRTGHDTPYATEAGAFLGTDHSTVVLDPRALLDPEHRRAVVVARDSPIGVGDM
DTSLHLLFGEIRKHSTVALSGEAADEVFGGYPWFHNPKALATATFPWLLVTGDEAAMPLN
PELDLRIGEFRDDTYRTALAAVPHLDGETPTEHRQREMQHLSLTRWLRQLLHRKDRLSMA
QGLEVRVPYCDHRLVEYAFTTPWALKNFDGREKSLLRAAGTGLAPDSVLHRPKNHYPATH
HPDYNRGLQNMARDALADDTVRSLADETRLKPCLDTPPGQLEWGHRLRLERVVDLALWLD
HYQPELAL
selected fasta
>putative amide synthetase [unknown]
ATGTGCGGAATCACCGGCTGGGTGTCCTTTCACCAGGACCCCCGCACCCAGGCCCCGGTC
ATCGAGGCCATGACCGCCACCCTGGCCCCGCGCGGCCCCGACGCGGCCGGAGTCTGGCTC
GGCCCGCGCGCCGCGATCGGCCACCGCCGCCTGGCCGTCATCGACCTCGCCGGTGGCGTC
CAGCCGATGACCGACCGGCCCGACGCCCCGACCACCGTGCTCACCTACAGCGGCGAGATC
TACAACCACCATGAACTCCGCTCACAACTGAGCGGCCTGGGACACGAGTTCCGCACCCGC
AGCGACACCGAGGTGGTGCTGCGCGGCTACGCCGAGTGGGGCGAGAAGGTGGCCGACCAC
CTGGACGGCATGTTCGCGTTCGCCGTCTGGGACGAGCGGGCCCAGCGGCTGCTCCTGGTC
CGCGACCGGCTCGGCGTCAAGCCCCTCTTCTGGGCGGAGGTGGACGGCGGTCTGGCCTTC
GCCTCCGAACCCAAGGCGCTCTTCGCCCATCCGGAGATACGGCCACGGGTGGACGCGGAC
GGGCTGCGCGAGGCGTACAGCCTGCTGTTCAACACCGGTCCGACGGTGTGGTCCGGCGTG
CGGGAGGTCGAGCCCGGCGGTCTGCTCCTCCTGGACCGGGACGGCATCCGCGAGCGCCGC
TACTGGCAGTTGGAGGCCGACGCCCACCCGGACGACCGGGACGCGACCATCGCCCGGGTG
CACGACCTGGTGAGCACCGCCGCCCGCGCCCAGCTCGAGGCCGACGTCCCCCTGTGCTCC
CTGCTGTCGGGCGGCATCGACTCCACCGTCCTGACCGCCCTGCTCGCCGACGAACTGCGG
CTGCGCGAGGGCCCGGGCGCGCGTATCCGCTCCTACGCCGTCGACTACAGCGACCAGGCC
GAGAGCTTCACCGGTGATGTGCTGCGCACCGGCCACGACACCCCGTACGCCACCGAAGCG
GGCGCGTTCCTCGGCACCGACCACAGCACGGTGGTACTGGACCCGCGTGCCCTGCTCGAC
CCCGAGCACCGCAGGGCCGTGGTCGTGGCCCGCGACTCGCCGATCGGCGTCGGCGACATG
GACACCTCGCTCCACCTCCTCTTCGGGGAGATCCGGAAGCACTCCACGGTCGCCCTGTCC
GGCGAGGCGGCCGACGAGGTCTTCGGCGGCTACCCCTGGTTCCACAACCCCAAGGCGCTC
GCCACCGCCACCTTTCCCTGGCTGCTGGTGACCGGAGACGAGGCCGCGATGCCGCTCAAC
CCCGAACTGGACCTGCGCATCGGCGAGTTCCGGGACGACACCTATCGCACCGCCCTGGCC
GCCGTACCGCACCTCGACGGCGAGACGCCCACCGAGCACCGGCAGCGCGAGATGCAGCAC
CTCTCGCTCACCCGCTGGCTGCGTCAACTCCTCCACCGCAAGGACCGGTTGAGCATGGCC
CAGGGCCTGGAGGTGCGCGTCCCCTACTGCGATCACCGGCTTGTCGAGTACGCCTTCACC
ACCCCCTGGGCCCTGAAGAACTTCGACGGCCGGGAGAAGAGCCTGCTGCGTGCGGCGGGC
ACCGGACTGGCCCCCGACTCGGTGCTGCACCGCCCCAAGAACCACTACCCGGCCACCCAC
CACCCCGACTACAACCGCGGCCTGCAGAACATGGCCCGCGACGCCCTCGCCGACGACACC
GTCCGCTCCCTCGCCGACGAGACCCGCCTCAAACCCTGCCTCGACACCCCGCCCGGCCAA
CTGGAGTGGGGCCACCGCCTCCGCCTCGAACGCGTCGTCGACCTCGCCCTGTGGCTGGAC
CACTACCAGCCCGAACTCGCCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000583 Class II glutamine amidotransferase domain (Domain)
 [48-168]  4.70000000000003e-45 PF13537
PF13537   GATase_7
IPR001962 Asparagine synthase (Domain)
 [240-533]  1.40000000000001e-58 PF00733
PF00733   Asn_synthase
IPR006426 Asparagine synthase, glutamine-hydrolyzing (Family)
 [2-536]  TIGR01536
TIGR01536   Asn_synth_AEB
 [1-607]  1.50000965748778e-124 PIRSF001589
PIRSF001589   Asn_synthetase_glu-h
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [223-395]  4.49999999999996e-68 G3DSA:3.40.50.620 [452-586]  4.49999999999996e-68 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR017932 Glutamine amidotransferase type 2 domain (Domain)
 [2-214]  PS51278
PS51278   GATASE_TYPE_2
SignalP
 [1-18]  0.116 Signal
Eukaryota   
TMHMM No significant hit