close all open/close all

CDS information : Herb_00060


close this sectionLocation

Organism
StrainAM 3672
Entry nameHerbimycin A
Contig
Start / Stop / Direction8,317 / 6,887 / - [in whole cluster]
8,317 / 6,887 / - [in contig]
Locationcomplement(6887..8317) [in whole cluster]
complement(6887..8317) [in contig]
TypeCDS
Length1,431 bp (476 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative transmembrane efflux protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF6p; ORF6
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
Q2AAU2
PmId
[17409524] Molecular cloning and characterization of a multidrug efflux pump, SmfY, from Serratia marcescens. (Biol Pharm Bull. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative transmembrane efflux protein]
MTDDASGADQAGDVPERPADPPEVHDRWLLVAVAGALAFVAMLDMNIVNVALADISQGLR
VPAATAQWAVLGYQLPVVALLLPVGRWLDDVGTRPALLVATGGFALCSALAAASPWAAWL
IAARIGQGACGAVLFVLMPVLALRSVRPELRGRAMSVPATLGPLGAVAGPAVGGLLLDHL
GWRWIFLVKIPFCLLALAVVWRAMPRDGRLRGADRRFLADTALIATGVTILLLSLTLASD
TPAWLPLALVAAPPLWWWLRGPGGRPVAGVLRAAGLLRAHGAVLALAVGFAAMHYVVALH
LQRDEDVSATTTGLTVLAFPLGMGLAGPLGGRLADRYGARPVAVTGAALTTVGLLLLVPL
GDGWSPPDVAWRLALAGLGMGLAGGPAQALVMGAAPPDRAATVGSTVQLARSLGFTLGPA
LATAAWGMAGQDDGVRAGLALAALAACLAVPLLARPARGPANRTEKTTDAAPAAPR
selected fasta
>putative drug resistance transporter [putative transmembrane efflux protein]
ATGACCGACGACGCGTCCGGTGCGGATCAGGCCGGGGACGTACCCGAGCGGCCGGCGGAT
CCACCCGAAGTCCATGACCGCTGGCTCCTGGTGGCCGTGGCGGGCGCGCTGGCGTTCGTG
GCGATGCTCGACATGAACATCGTCAACGTGGCGCTCGCGGACATCTCCCAGGGCCTGCGG
GTACCGGCGGCGACCGCCCAGTGGGCGGTACTCGGCTACCAACTCCCCGTCGTCGCCCTC
CTGTTGCCTGTCGGCCGCTGGCTCGACGACGTGGGCACCCGCCCCGCGCTGCTGGTCGCC
ACCGGTGGCTTCGCGCTGTGCAGCGCGCTTGCCGCCGCGTCCCCCTGGGCGGCCTGGCTG
ATCGCCGCCCGGATCGGACAGGGCGCGTGCGGCGCGGTGCTGTTCGTGCTGATGCCGGTG
CTGGCGCTCCGCTCGGTGCGGCCCGAGCTGCGCGGGCGGGCGATGAGCGTGCCCGCGACC
CTCGGCCCCCTGGGCGCCGTCGCCGGACCGGCGGTCGGCGGTCTGCTCCTGGACCACCTG
GGCTGGCGCTGGATCTTCCTGGTCAAGATCCCGTTCTGTCTGCTGGCGCTGGCCGTGGTG
TGGCGGGCGATGCCCCGGGACGGCCGCCTGCGCGGCGCGGACCGGCGCTTCCTCGCCGAC
ACCGCCCTGATAGCCACCGGTGTAACGATCCTCCTGCTCTCCCTGACCCTGGCCTCCGAT
ACCCCCGCCTGGCTGCCGCTCGCCCTCGTCGCCGCACCGCCGCTGTGGTGGTGGCTGCGG
GGTCCGGGCGGCCGTCCGGTGGCCGGTGTGCTGCGGGCGGCGGGGCTGCTGCGGGCGCAT
GGCGCGGTGCTGGCGCTGGCGGTGGGTTTCGCCGCCATGCACTACGTGGTCGCCCTCCAC
CTCCAGCGTGACGAGGACGTCAGCGCGACCACCACCGGCCTGACGGTGCTCGCCTTCCCC
CTCGGCATGGGGCTGGCGGGCCCGCTCGGCGGACGGCTCGCCGACCGGTACGGGGCCCGG
CCCGTCGCGGTCACCGGCGCCGCGCTCACCACCGTCGGCCTGCTGCTGCTCGTCCCGCTG
GGCGACGGCTGGTCCCCTCCCGACGTGGCCTGGCGGCTCGCCCTGGCCGGACTCGGCATG
GGCCTGGCCGGCGGCCCGGCCCAGGCCCTGGTCATGGGGGCCGCCCCGCCGGACCGCGCC
GCCACCGTCGGCTCGACCGTCCAGCTCGCCCGCAGCCTCGGCTTCACCCTCGGACCGGCC
CTGGCCACGGCGGCCTGGGGGATGGCGGGCCAGGACGACGGCGTACGGGCGGGGCTCGCC
CTCGCCGCCCTCGCCGCCTGCCTCGCCGTACCGCTGCTCGCCCGGCCCGCCCGCGGTCCC
GCGAACCGCACCGAGAAGACCACCGACGCGGCGCCCGCCGCACCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [33-57]  5.49999942632758e-05 PR01036 [124-144]  5.49999942632758e-05 PR01036 [154-178]  5.49999942632758e-05 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [37-238]  4.2e-31 PF07690 [286-470]  9.9e-18 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-469]  7.29994178862692e-70 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [30-458]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [29-51]  Transmembrane (i-o) [66-88]  Transmembrane (o-i) [95-117]  Transmembrane (i-o) [121-143]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [181-203]  Transmembrane (o-i) [216-238]  Transmembrane (i-o) [242-259]  Transmembrane (o-i) [276-298]  Transmembrane (i-o) [308-330]  Transmembrane (o-i) [337-359]  Transmembrane (i-o) [369-391]  Transmembrane (o-i) [412-430]  Transmembrane (i-o) [435-454]  Transmembrane (o-i)
Transmembrane 14